Identifiers and Description

Gene Model Identifier

TTHERM_00089190

Standard Name

PAP2 (Poly(A) Polymerase)

Aliases

PreTt16470 | 6.m00544 | 3836.m02136

Description

PAP2 poly polymerase central domain protein; Poly polymerase central domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01909 ) Nucleotidyltransferase domain
  • ( PF04928 ) Poly(A) polymerase central domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02507.1 9.997093137033517e-262
Description: poly polymerase central domain-containing protein (600 aa)
Oxytricha Contig11888.0.g8 9.9952060159684e-60
Description: Poly(A) polymerase central domain
DictyBase DDB_G0288259 1.9992362000979228e-56
Description: papA on chromosome: 5 position 1302980 to 1305635
WormBase WBGene00011791 4.001202823045957e-54
Description: status:Partially_confirmed UniProt:Q09995 protein_id:CAA87419.1
SGD YKR002W 2.0005131442217614e-40
Description: PAP1 Poly(A) polymerase, one of three factors required for mRNA 3-end polyadenylation, forms multiprotein complex with polyadenylation factor I (PF I), also required for mRNA nuclear export; may also polyadenylate rRNAs; required for gene looping
Stentor Coeruleus SteCoe_27185 5.242885663363464e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00089190(coding)
ATGAGTTAATAAAATTCTTCAAAAAAAGATTTTGAATCAAAATATAGTCGTGTGATATTC
ACTGAACAGGAAATTAATATTATGAAAACTCCCCATGCTATTATGAGCAACTAAAAGGGG
TGGAAAAAGGATAGAGAAAGATCCTAAGAAATTGATTATATGATGAAACCATATTTTGGA
ACTGAAGAAACAGAACTTTCTAAGTAAAGGTATGTCAATGAGCTGCAAGAAATAGTCACT
AAATGGAGCACTGAATTAGCTTAGTAAATATTAGGTGTATCATCAGAAGAAAGCAAAAAG
TATACTGCTAAATTATTGACTTTTGGATCTTCTATTTTAGGTGTTAGCTCTAAAAAGGGA
GATATTGATATGGTTTGCACATGTCCTAATTTTATTAAAAGAAATCCTCATTTTGAAGAA
GAACTATGTTAAATTTTGCTGAATAATGAGAATGTTAAATAATTATCCAATATTCGTACT
GCAAAAGTTCCAATCATTACATTTTAATACAAAGAGTAAGATATCGATATATCGTTTGCT
CAATTGCAACTTCCTTAGTTACCTCCTACTATAGAAGAATATGTTAGCGATGATCTACTT
TAAAACATGGAAGAAAGAGATATCCTGTCTCTGAGCGGTAGAAGATGCAACTAAGCTATA
GTTAGGAGTGTTCCAAATTTATAGAATTTTTAGATTACTTGCAGATTTATCAAATTGTGG
GCATAATCAAAAGGAATATACGAAAATTCTATAGGATTTTTAGGTGGTATAAGTTGGGCT
ATTCTTGTAGCTAAAATATGCTAAATGTTTCCCAATTATGAAGCTAATTAATTGCTAGAT
GAATTTTTTTATTACTATTCTAACTGGGACTTTACAAGTGTTCATGTGTTACTAAATGAT
TACTATAACTAGAGAACGCCTAAATAAAGAGCTATTACTCTTTACATGAATGTAATGACA
GCCTGTTATCCAGAATACAATTCTACAGAAAGGGTCAAAGAAATTACTCTTTACATCATT
AAATAGAGATTACATGAAGCAAATGAATTAATATAGAAAGAAATAAAATACTAATATAAA
CACTATAAAGACTTGTTAGTAAATTATGATTTTGTTAATAACTATTAGGTCTTTATAGAA
TATAGTTTATAGTACCCGGAGAAAATTAAAACATAAGTAACTGACAAGGAATTTGAGGAT
TTTATGAATGCTTCTAAAGTAAAAATATTAAATTTGATATAAAGACTATCTGAATCTCGT
CCATAAGGTGTTGAGTTTTGCCCATGGCCTTAGTTTTTTGCAAAAACATAGGTGTCTTAT
AAAAAAATTTAAGTGCTTTATATAGGGATAAATGATAATTCAGAAGAAAAAAACTAGGAT
TTAGAGAAGGACTGTAAACAACAAATATAATCGTTTTATCAGCTTCTTAAGAATGAGCAA
AAATATTCAACTTATTTGGAAAAATTCGATGTCGGTATGGATTGGATCAGCAATAAAGAA
ATAATAAGAAAAACTTTTAAGTTAACTCAGGGCACATACGAAATAACAATTCCTAAAGAA
GATTAACAAAAATAAGACATTTCGAAGTATGAAGTTACAGTACAAAAAAAAATTAAATTG
AATGAGTAAGGAAATTAAGCAAGCAGCTCAAATAACAATGATATTAAGGATTGTTCGAAC
GAAGATGATCAGTAGTAGCAACTTCAAGTAGGTGAGGAAGAAGAATAAGCAGAGGAAAAT
TGTGATATCAACGATTTTTATTGA


>TTHERM_00089190(gene)
ATGAGTTAATAAAATTCTTCAAAAAAAGATTTTGAATCAAAATATAGTCGTGTGATATTC
ACTGAACAGGAAATTAATATTATGAAAACTCCCCATGCTATTATGAGCAACTAAAAGGGG
TGGAAAAAGGATAGAGAAAGATCCTAAGAAATTGATTATATGATGAAACCATATTTTGGA
ACTGAAGAAACAGAACTTTCTAAGTAAAGGTATGTCAATGAGCTGCAAGAAATAGTCACT
AAATGGAGCACTGAATTAGCTTAGTAAATATTAGGTGTATCATCAGAAGAAAGCAAAAAG
GTAATGCAAAAAATCCTATTTTTATTTCTTAATAAATAATTTAAATTCTAATTATTTAGA
TAGATTAAAATGGTTAAAAAAAAGGAAAATTACGATGAAAATCTAGTTAAAAATTTTAAG
ATATTTTAAAAATTAGCAAATATCCATTTTTACAGCTATATTAATTTGAAATTTTTATTA
ATTTGAATTCATTTTAATTGTATTTTAATATTTATAAAGTATACTGCTAAATTATTGACT
TTTGGATCTTCTATTTTAGGTGTTAGCTCTAAAAAGGGAGATATTGATATGGTTTGCACA
TGTCCTAATTTTATTAAAAGAAATCCTCATTTTGAAGAAGAACTATGTTAAATTTTGCTG
AATAATGAGAATGTTAAATAATTATCCAATATTCGTACTGCAAAAGTTCCAATCATTACA
TTTTAATACAAAGAGTAAGATATCGATATATCGTTTGCTCAATTGCAACTTCCTTAGTTA
CCTCCTACTATAGAAGAATATGTTAGCGATGATCTACTTTAAAACATGGAAGAAAGAGAT
ATCCTGTCTCTGAGCGGTAGAAGATGCAACTAAGCTATAGTTAGGAGTGTTCCAAATTTA
TAGAATTTTTAGATTACTTGCAGATTTATCAAATTGTGGGCATAATCAAAAGGAATATAC
GAAAATTCTATAGGATTTTTAGGTGGTATAAGTTGGGCTATTCTTGTAGCTAAAATATGC
TAAATGTTTCCCAATTATGAAGCTAATTAATTGCTAGATGAATTTTTTTATTACTATTCT
AACTGGGACTTTACAAGTGTTCATGTGTTACTAAATGATTACTATAACTAGAGAACGCCT
AAATGTAACGCACCATATTCATCTTATATTACTATTTTAATATAATTTTCTTAATATACT
CCGTATCTTTGTTTATATGTTCAAGAACATGAAAATCTTCTTACTTAATTTCAATTTTAC
TTCTTAAGATTTCATCAATTAATAAATAAATAAATCAATCAATAAATTAATGAATCAAAA
TGCTGTTTTTACTTACTTACTTATCTATTTTATTAAAATAATTTCAACCTACTAATACTA
TATTATTATTTTAACTTACTAAAATATCTCAGAAAGAGCTATTACTCTTTACATGAATGT
AATGACAGCCTGTTATCCAGAATACAATTCTACAGAAAGGGTCAAAGAAATTACTCTTTA
CATCATTAAATAGAGATTACAGTAAAATTAATTTGTTTTTTTTATTAAATTTTAACTTAC
TATTAATAAACCAACAAAAAAACGAGATTTTAACTTCGTTAATAATTTGATGATTTTCTC
TAAAATTTAACTTCTTTTAAAAAAAAAAGAAGAGGTATTTAAGAATATATTTTATACTTG
CTAATTAAACCAATTTAAAAAATTATTTATTGATATTTTAAATAAAAAATATTTTTAAGT
TTTAACAACTTCCCTCATTTTCATATAATTCATTTTGATCAGAAATTTCATTGATAAAAA
TACTTTTGAAATTCAATCACAAAAATATAAAAATGAAATATTTAAAAAATATGAATAAGA
GAGATAAAAATTATGAAATATCAAATACTTAAATGATATTTTTATTTTTTTTTAAATTAT
AAAAATAGTGAAGCAAATGAATTAATATAGAAAGAAATAAAATACTAATATAAACACTAT
AAAGACTTGTTAGTAAATTATGATTTTGTTAATAACTATTAGGTCTTTATAGAATATAGT
TTATAGTACCCGGAGAAAATTAAAACATAAGTAACTGACAAGGAATTTGAGGATTTTATG
AATGCTTCTAAAGTAAAAATATTAAATTTGATATAAAGACTATCTGAATCTCGTCCATAA
GGTGTTGAGTTTTGCCCATGGCCTTAGTTTTTTGCAAAAACATAGGTGTCTTATAAAAAA
ATTTAAGTGCTTTATATAGGGATAAATGATAATTCAGAAGAAAAAAACTAGGATTTAGAG
AAGGACTGTAAACAACAAATATAATCGTTTTATCAGCTTCTTAAGAATGAGCAAAAATAT
TCGTAAAAATTTTTTAATTAGGTTTAATGTTAGTGATTTAAAAAGATGATTGATTGATTG
CTTTTGCTTATTTGATAGACTTACTCAATATCTATTTTTTTTTTTATTTATTTAAAATTA
AAAACAGAGTGGATTTATTTAGAAAGATCCACTAAAACTCTTTCTTTTTGATTTAAAATT
TATCTTACTTCTTTAATAAAACTCTAGAACTTATTTGGAAAAATTCGATGTCGGTATGGA
TTGGATCAGCAATAAAGAAATAATAAGAAAAACTTTTAAGTTAACTCAGGGCACATACGA
AATAACAATTCCTAAAGAAGATTAACAAAAATAAGACATTTCGAAGTATGAAGTTACAGT
ACAAAAAAAAATTAAATTGAATGAGTAAGGAAATTAAGCAAGCAGCTCAAATAACAATGT
AAATTAAAATGAAGAATTTAATACAAAAAGCAATAATTATTTTATAACTAGGATATTAAG
GATTGTTCGAACGAAGATGATCAGTAGTAGCAACTTCAAGTAGGTGAGGAAGAAGAATAA
GCAGAGGAAAATTGTGATATCAACGATTTTTATTGA


>TTHERM_00089190(protein)
MSQQNSSKKDFESKYSRVIFTEQEINIMKTPHAIMSNQKGWKKDRERSQEIDYMMKPYFG
TEETELSKQRYVNELQEIVTKWSTELAQQILGVSSEESKKYTAKLLTFGSSILGVSSKKG
DIDMVCTCPNFIKRNPHFEEELCQILLNNENVKQLSNIRTAKVPIITFQYKEQDIDISFA
QLQLPQLPPTIEEYVSDDLLQNMEERDILSLSGRRCNQAIVRSVPNLQNFQITCRFIKLW
AQSKGIYENSIGFLGGISWAILVAKICQMFPNYEANQLLDEFFYYYSNWDFTSVHVLLND
YYNQRTPKQRAITLYMNVMTACYPEYNSTERVKEITLYIIKQRLHEANELIQKEIKYQYK
HYKDLLVNYDFVNNYQVFIEYSLQYPEKIKTQVTDKEFEDFMNASKVKILNLIQRLSESR
PQGVEFCPWPQFFAKTQVSYKKIQVLYIGINDNSEEKNQDLEKDCKQQIQSFYQLLKNEQ
KYSTYLEKFDVGMDWISNKEIIRKTFKLTQGTYEITIPKEDQQKQDISKYEVTVQKKIKL
NEQGNQASSSNNNDIKDCSNEDDQQQQLQVGEEEEQAEENCDINDFY