Identifiers and Description

Gene Model Identifier

TTHERM_00091620

Standard Name

NUP308

Aliases

PreTt16515 | 6.m00589 | 3836.m02175 | Nup308

Description

nucleoporin putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02524.1 9.997093137033517e-262
Description: hypothetical protein (2551 aa)
DictyBase DDB_G0291390 2.9992476920535046e-16
Description: nup98 on chromosome: 6 position 239658 to 246409
SGD YMR047C 0.0000000029989608248573072
Description: NUP116 Subunit of the Nup82 subcomplex of the nuclear pore complex; localized to both sides of the pore; contains a repetitive GLFG motif that interacts with mRNA export factor Mex67p and with karyopherin Kap95p; homologous to Nup100p
WormBase WBGene00003797 0.000000030002053728821195
Description: locus:npp-11 status:Partially_confirmed UniProt:O01576 protein_id:CCD66423.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28386019: Iwamoto M, Osakada H, Mori C, Fukuda Y, Nagao K, Obuse C, Hiraoka Y, Haraguchi T (2017) Compositionally distinct nuclear pore complexes of functionally distinct dimorphic nuclei in the ciliate Tetrahymena. Journal of cell science 130(10):1822-1834
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00091620(coding)
ATGGCAGCAAATACAGGAGGAGGTTTATTTGGAGGACAATAGACTTAATAAAATTAGGGT
TTATTTGGAGGACAATAGACTTAATAAAACTCGAGCTTATTTGGAGGTCAATAAGCATAA
AACTAATAACAAGGTTAGGGCGCATAAGGATAATAACAAGCTTTCTCTTTATTTACCAAC
AATTAATAAGGCTAAAATAATCAATAAGCAAGTTCTAATTAATAAAATATATTTGGTGGT
GCTATATAATAACAATAAGGAGGAGGAAACTTATTTGGCTAAACTCAATAAAGTTAATAG
TAAGGTACTGGTCAACCATCAGGATTATTCGGGGGTATAGGTAATATGAATTAATAGCCA
GCAGCTAAGTAAAATGAAACACCAGTCCCTCCTTAAACTCAAAATTAATTGTTTGCAAAT
ATATAGAATTAATAGTAGCCTCCTTAATAATAAACTTAAAACTAAGGTTAATAATCTTAA
TAGTAGCAACAATAACCAACAAGCACAAATGGCTTATTTGGAAATGTTTAGTTAGGAGCA
TCAAATTAAAATCAGGCTTAAAACAATACCCAAAATTAGTAAGCTGAAAAGCCAAATTCT
CTTTTTGGAGATAAGCAAAATCAAGGAGCTCCATAAGTCACAGGAGGCTTATTTGGTAAC
TCTGCTAATTAAGGCACAGGAATGCAAATCAATACTAATAAACCAGCAACATCAGGTTTA
TTTGGAGCCAATTAAACAGATTAATAGTAAAATAAACCTATAGGAGGAGGAATCTTTAAT
TAAATGTAATAAAATGCCTAAAGCTAATAGACCCAATAGTAATAATAACCTCCCACATAA
ACTGGTGGTGGCTTATTCGGTTAGACATAATAATAGTAGTAAACTAATGCTCCTCCTAAA
GAAGAACCAAAGACATCTTTAGGTGGATTAAATTTATTAGGTTAAGCTCCTTTAAATACT
TAAAACTAGTAGAATTAAGCCCCAAAATAACCTGCATAAAGTGGCGGCTTATTTGCTTAG
GCTCCATAATAACAATAATAATAACAACAACAACAACAATAAAATAATACATAACCAACT
ACAACAACTACAATTCCTTCTACAAATTCTTTGTTTAATAATGCACCAAATACATAAGCT
GGTGCAACTACTACTTAAACAGCATAAACTACATAAACAGCAGCAGCTCCTCCTAAAAGT
TAGGGACCAAGTTTATTTGCATAAAATAACTAACAAACAGCACAACCACCAGCTAATTCA
CAACCAACTTAGTAAGGATAAACATAAGGAGGAGGTCTATTTGGTGCTAACATAGATGCT
TAAAATGCTGGAAGTAGCTAACCTAAGTTTTTAAATATAGGAGCTAATAAAGATAATATA
TTAGGTTAAGGAAAGACAAACTAACCTGAAGGACTCAATATCGGTGGAGGATAAAAAGGT
ATCCTGACAGGTGCCTCTGGAGCAGCAGCAACTACTACTACTACCGCAGCATCTACTACT
GATGCTACTAAACCAGCTCAACCCTCAATCTTAACTGGATAAACTCAAGCAGCCTCTAGC
CTTTTAGGAGGATAATAAAAACCAGCAACTAATCCTCCTACTATAGGAGCTACCTCTTAA
ACTACTGGTGGCTTAGTAGGAACAGGTTTAGCAGGTCAATCAAATTAAATTCCAGCTCCC
AAAAAAACTCATTAACATACTTCTTAAGCAACTGGACCAGATGAGAGATTAGAAATGGAT
ATTAATTCTGCTAAAAATCTTAATGGAAGTTTACACATGTTTTGCCAAAATATCCATAAG
TATAAACCTGAGCATGTTAAAAAATTCTTTTCTAATGAGGACATTTTCAATAAATTAACA
TAAGGTCTTCAAATATATAAAGGAGAACAAAATACAGATTAATGGGAGAATATAAAAAAG
GAAGCCAAGGAAGGAAAGACTCCTTTGAAGTTCTGGAGTGAGAGATTATCAAAATATAAA
TATTAGTATTTGATTGTTATGTTTATTGAAGATATTGCTGAATATCTTTAAATTAAACCT
ATGGATTGTTACCGTATGTTTGATGTTTTCCTTTCTCACGAGAGCAAATTTGTCGACTAT
TTCTTCAATCCTTCTTCTAATGAACCTTGCATCGAATTTTTCTACGAATAACAAGCTATT
TTATTTGAATCTAACAATGTTGCAGTAAGAAAGGACTCTCCATTTATAATTAATTTGAAA
ACTTCTTTTATGAAAGACATTTATTTCCATGAACGTAACTGCATACTTGCCTCCCTCCGT
CTTCTTTTACTTTTCACTGATGACCAATACAATTACGATGCTGTTAGAGATGTTGTCGCT
CGTCTCTTAAGAAACAAATTAGAAGAGTCTTTATGGGAATAATATGCTGGATAAAACAAT
AATCCTGAATTAAGTGCAGAAGATAGCGAGCTATTCTAACTTTAAAAATAATTTGAAAAC
GACTAAATCATTAAGCTTTTATTCATTATCACTTAAAAAAATCAAAGCAAAATTAGCATA
GAAACCTATTTACAAAAATTCAATAGCTAAAACTTCATGGGTAATTGGTAAAATTTACAA
CCTCAAAATGAAAACACCTTTGAAAATAAAAATAAAATTAACGAGTTATCAACAGTAGTT
GGTGATTCTTGTTTGATGTTAGTATTTGCTAAAGTAAAAGAAATTTAATAAAATAAAAAC
AAAAATGAAAAAGATGCATTTGAAAAGATATTTAAACAATCTTAAACTAGCTCTTAGAAG
AGCTAATAAATGAATGTTTTAAAGCTTTACTATGACTCTATAAGCTAAGAATAATTGGTT
GTTGAATTTTATGAATAAATTGAATATCTCTACAAAACTATTGTTAGAATTCTTAATTAT
AAGAATTTGGGAACTCTCAAAACTTAATGGTAGGAAATATTCTTTGAATTGCTCGTAAAG
ATTATTTAAGGAATTAACGCAAATGAATTCTATGAAGAAATGGATGAATAGCTAGAATCT
TTCATTAGTGAATGCATTTGTATTGCATTTTCTAAAACTATACACAAAAATCCTAAATTA
ATTGACTTATTCTGGGAAAAGCTCGAAAGCAGAGAACAAACTAAGCATTTCCAAAATATC
TTTTCTAGTCCTATTTCTATTTACAAAGTAATGAAAAGTGCACTAGGTATGAGCTCCGAC
CCTAAATCTCGTCATGTTATCATCTTTTTGACTACTTTAAGCAATTTTAATTGGATTAAC
TTTAACTAAATAGCTGACTCACAATAAAATTTAGATACTGCAAGCATATTAAAATTGAGA
TTAATTTATAAGCTTATAATTACTGATCCTAAATGCATTAATTTACTTTAATATGTATTT
TACTTCACTGATTTATCATAGAATACTTTCGATTAATACATAAATGAATGCAATGGTGAT
GAAGTAATTAAATTTGTGATAAAGAGTTTTGCATTATATAACGATTTGCGTAGCTATGCT
TATTAAAACTTCTTTGCTGGTCTTAAGGCCTTAAATGTATTGCTCAACAATCACTAATAC
TAGACACAATAAATTTTGTAAATCGAAGAATATTAAGATTTGCTCTTCAAAGAATATAGA
CGTTTAGCAATATAAAATGATGTGACTGCCACTGAATACAGATTAAAATGCAAGAGAGAA
ATCTTAAATATCTTATACACTATTTTAAAGGATTTCGAAGAGCCTTTGCTTGCTTTCTCT
CAAATAAAAGGAATGGAAAGAAACACAGAATATGATTCTCCTTTACTTGCTCATTTGTTC
CTCTTCTTCACTAGCTTTATTGAAGATTGGGAATAAAACTAAGGCGCTCTTTACCTTAAG
CATAAGTGGAAAATAGGCTCTTTAATCATGAAAATTACTGATATTTGTTTAAACAGATTA
TCAATAAATGTCTATAAGAAACAAGACTTCAGACCTGTTTAAAGTGATAGCTATACTAGC
TTTTTCTTACACAACTTCCTCTGCAACTAATTAAAGAAAATCAGAGTAGATGAAATGATT
ATCAAGGTGCTTGAAGTAGCAGCTAACTAATCATCTATTAGTAACAACAAGATAAACAAC
AAAACTCTTAAATTGAATAACAAGTATTGGTAAACTTATATCATGAATACCTCAAATAAA
TTTAAAGAACACTAGGTTGAACACATTAAAAACTAAGTTAATTTAAGAAATCTGATTGTT
GACACATTGAAGGTGTTAGAAACTACTATGCAATTAATTGAATAAAAAATTTAAATCCGT
AAACAAGATTTCGAATATAGATTTTTACAGAAATCAATGCTTTTAGATGAAATCCCAATT
TTAGATTTCTTTGAAAGAATAATATGCAAATCTGACTGTATCTTCCATTACAAATAAGAA
TATTACATTGACTCAAGCTTAAACTCAATAAAAATAAATATTTTATACGCCATATCCTCT
TACATTAACTTTGAAAATCATTTCTACTCTTCAAACGATGAAGTTAACCCAACACTTCCC
TTTTATATTTACAATTTCTTGGAAAGTGAAGGTAATTTAATTAACTAATTGGCAGATACT
CATTACCTTCTCGACTATGACACTATTAGAAACCCATTAAATAATTCTCGTTTACCAAAT
GGTACTTACTGTGAATTGATTAGCTCTTTGAGTTTGAGAATTTTAACTTAAATCATGTTG
GCTTGGGAAGCTCAATAGTCAATTAGAAAACCTATTTTAGTAGATTTCTTAAGCAACATG
AATATGGAAAACTACTGGGAGAAGTTAAATTACTCTTCTATTAACACTTAATTAACTAAT
TTCATAATTGAGATGTTTAACATATTGAAATTGAATGAATATGATTCTAACAATGATAGT
GAAGCTCTCAGAAAAAACATATCAGACAACAGCTGTGCAGTTATCGATTTCATGCTCACT
GCCTTATACACTCAACCTCTCTTCATGAACTTGATTCTTAAACCTGATAATCTTAACAGA
AAAAAGAAAGATAATGATCTTAAAATCAGATTTAAGCGCTTCTTTGAATCAAATGTTTGC
ACTTATGACATGCGTTTACTCAACAAATATTTGAATCTTTTAGTTGAAATCTTTAAGAGA
GATTAAATGTACCCAAGCTTTTGTTAGGAATTCCGTTAAGACACACAATATATTTTCGAA
AAGATTACTAAAGTCGTAGTTTAAAACTTTAAACCTTATGAAATCGACTAGCTCGTTGAA
AGAGATCTTTACTTTTTAAATTCTCCCAAAGAACCAAATATTCCTTACTTCGAGTTCTAA
AAATTAAAGTTATCTCAATTACTTAGAGAACACATAAAATAAACAGAACTCTACTAATAG
ATGATTTGCTTACACAGTTTCTAGATTTTACTTGATTTAATTAGCAAAGAATATCTTTCC
AATAAATGTAAATCAGTCCAATCTATCCAAAATAGCTTAAAAGCAATATTCGAAAATAAA
TAAGTTAATCACATCATGAACAGCTTATCTAAGTTCGCTCCAAGCTATTCATTAGATCTT
TGGCCAGTTCCTCAATAAATTCAAACTAAGATGAACATTGAAAATGAAGAGTAATTTAAG
GGAAAAATTTTCTAATAATCTTTCTTCTATTTGTTGGAAACTAACCAATATTCATATGGA
AGAGGATATGCTTTGGATGCCAGTGAGATTATATTCAATAAAATAGACGCTGAAAGACCT
TAAGACTACTTGTCTAGAGCTAAATACATTCTCTTTAAATTAATTGAATTCCGTCAAAAG
AGTATTAAATGGTCTATTGAAGAAATAAAACTAAGGACATTTGATTCATGGATTAGACTA
TTTTGTTTAGTTACTTCTTCAGGAGTTGAAGGTTACGCTATGAGTACTGTACAATCTTCT
ATTCCAAATTTCACTCTTAAGTAGCTCAGAGAGAGAAAGATTATTTTAGAGCATGAATAA
TTATGTTTACTCTATCCTAACTATGAAATAGAGTTTGTGAGTGGATTTGTTAACATCTTC
TGTGCCTCTAACCCACAATGTGTTGGTCTTTTCTCTAACTTATAGAGCGAAATGATGAAA
TAAATTCTCTAAGATTTGAAAAAAGGGTACTTTGGAGTGCTCTTTGATCAAAAACTCAAA
TTTTTACTTTACATATTATTCTCACTCAGACACTTACAAGATCTAGACTACCATTCCAAA
GAGTCAGAAAATAAAAAGACATAAAATCCTAATAATTTTATTGGTAGATCAAACTAAAAT
CAAGAAAGCTAACATTCTTTCTCAGATTCTTATAAAAAAGAAGAAGCCGAAGATTTATTC
AAAGTAATGACATAAATTTTAGAAGAAGCTGTCCATCGTGGTACTAGAGTTCAAATATGT
GATTTCATTTAGTGCTTATTCTTGCAATTACAAGTGATGGAAGTTCTCTACTTATAAACC
TTCTAAAACAACAAGAAAAAATTCGTTATCAATGAAAACTTGAATCCTTACTTTACAAAA
ATAATTGGTATTTTAATGAATTTGGCTGCTTAGAATATTGATGGTCTCCCTATTTTAATA
TCTTGTCTTAACAGTGCCCTACATATCTATCCATAATACTTTATTCTTTAATTCAAATAT
CAAGTTAAAGCTTTAGAATTTTTGATTAATAAAATCTTTTATGAAAAGAATGAAACTGCT
TAAATCTTTGTTTCTATTATAAATCTGTTGACAGATATTGCTAAGTATCCTGAAGGTGCT
CTTTTATTGAGTGAAGCTAATATTGTAAGTATGATATGCAACACTCCCATTTTTAAGAAT
ATAGAAAATGAACCATTCTATTGGCAAAATGGAGAAAGAAATCTCTTACATTCTTTCTGG
TGTTGGAGTTTGAATTTCTATAAGGAATATATAATTTCATTGCCTTCAGATTTAGAAAAC
ACAACTTCATCTTTCTAATTCTTATAGACTTATTTCACTCGTATTGCTAAAATTCTCTCT
ATTCCTCAAGTTTTATAAAACACTGCTACAAATTTAGCTAATAACAAAATGATTAACACT
GAATAAGAAAAGCTTTCTCTTGCATATATGGAAGAAATCGAACTTATTTTGGAACTTCTC
TCAGTTTATTTCTGCCAAGCCAATATCTTCAAAAGAAAGATGAGCAACGATTTTGAATAA
ATACTTCAATTCTTGACTCATTGCACTATTTGCTTATTTAAGTAGGGTCTTTCCATCCAA
TCTATCTTCATGCCAGTTTCTAAAATGGAAAAGAAGCTCTCTCAAATTTATGACATTTAT
CAGGTCAGCTCAGCAGACAGTGCTCACTTATATCACACATCTATACTTACTCCTTCTCAT
ACTCCAAACAAATAAGAGTTAGAAGCAGGCATCTCTACAGCTCACTCTGCTATTGGAGAT
ACAAAAAATAAGAACTATAACTTATTCATCATTTAAGTTGAATTACACTACTAGAGCATT
TTATTCAGTTTGTTTTCTTGTATCTAAGACGGTTTACAAGAATCAAGTTTACTTTAATTA
TTCTAATATTCTAGCAACAGCTTCAGTGATAATTTGATCAATAATGAAAGCAAGTAAGTT
TATTCTGTAAATTACTGGTAGAGCTTTGCAAATTCTTTGTTTGACTGCCTTAAATTCGTA
GAAAATACTCTAAATAAATGGGATTATAAGAAAAATAAAAATGTTAATATGGATGACTAG
CTTGTCAAGCTTCGCGCTCTCACAAATTCTGTAGAGTATAACTTATGTTGCTATGGATTT
GGTTCTCAAACTTCTTTAATAAATAGTGCTAAAACAATTATTTAAACATCTTAATTTAGT
CTTTAAGCTATCGTTCTTTCTGCTATCAAGCACTTCTAAATGTTAAACGAATTCAAATAA
TGGTTTGGACACTCTATAAAAGACAGTTTAACTGATTTATAAAATAAATTAAATGCAAAG
CTAGATGGATTGAAGAAACTAGAATATGAAGATATTTAACTTAAAAAATAAATTGAAGAG
CATATTTTACAATTCTAAAGGCTATCAGTGACATAAGATAGATATTGA


>TTHERM_00091620(gene)
ATGGCAGCAAATACAGGAGGAGGTTTATTTGGAGGACAATAGACTTAATAAAATTAGGGT
TTATTTGGAGGACAATAGACTTAATAAAACTCGAGCTTATTTGGAGGTCAATAAGCATAA
AACTAATAACAAGGTTAGGGCGCATAAGGATAATAACAAGCTTTCTCTTTATTTACCAAC
AATTAATAAGGCTAAAATAATCAATAAGCAAGTTCTAATTAATAAAATATATTTGGTGGT
GCTATATAATAACAATAAGGAGGAGGAAACTTATTTGGCTAAACTCAATAAAGTTAATAG
TAAGGTACTGGTCAACCATCAGGATTATTCGGGGGTATAGGTAATATGAATTAATAGCCA
GCAGCTAAGTAAAATGAAACACCAGTCCCTCCTTAAACTCAAAATTAATTGTTTGCAAAT
ATATAGAATTAATAGTAGCCTCCTTAATAATAAACTTAAAACTAAGGTTAATAATCTTAA
TAGTAGCAACAATAACCAACAAGCACAAATGGCTTATTTGGAAATGTTTAGTTAGGAGCA
TCAAATTAAAATCAGGCTTAAAACAATACCCAAAATTAGTAAGCTGAAAAGCCAAATTCT
CTTTTTGGAGATAAGCAAAATCAAGGAGCTCCATAAGTCACAGGAGGCTTATTTGGTAAC
TCTGCTAATTAAGGCACAGGAATGCAAATCAATACTAATAAACCAGCAACATCAGGTTTA
TTTGGAGCCAATTAAACAGATTAATAGTAAAATAAACCTATAGGAGGAGGAATCTTTAAT
TAAATGTAATAAAATGCCTAAAGCTAATAGACCCAATAGTAATAATAACCTCCCACATAA
ACTGGTGGTGGCTTATTCGGTTAGACATAATAATAGTAGTAAACTAATGCTCCTCCTAAA
GAAGAACCAAAGACATCTTTAGGTGGATTAAATTTATTAGGTTAAGCTCCTTTAAATACT
TAAAACTAGTAGAATTAAGCCCCAAAATAACCTGCATAAAGTGGCGGCTTATTTGCTTAG
GCTCCATAATAACAATAATAATAACAACAACAACAACAATAAAATAATACATAACCAACT
ACAACAACTACAATTCCTTCTACAAATTCTTTGTTTAATAATGCACCAAATACATAAGCT
GGTGCAACTACTACTTAAACAGCATAAACTACATAAACAGCAGCAGCTCCTCCTAAAAGT
TAGGGACCAAGTTTATTTGCATAAAATAACTAACAAACAGCACAACCACCAGCTAATTCA
CAACCAACTTAGTAAGGATAAACATAAGGAGGAGGTCTATTTGGTGCTAACATAGATGCT
TAAAATGCTGGAAGTAGCTAACCTAAGTTTTTAAATATAGGAGCTAATAAAGATAATATA
TTAGGTTAAGGAAAGACAAACTAACCTGAAGGACTCAATATCGGTGGAGGATAAAAAGGT
ATCCTGACAGGTGCCTCTGGAGCAGCAGCAACTACTACTACTACCGCAGCATCTACTACT
GATGCTACTAAACCAGCTCAACCCTCAATCTTAACTGGATAAACTCAAGCAGCCTCTAGC
CTTTTAGGAGGATAATAAAAACCAGCAACTAATCCTCCTACTATAGGAGCTACCTCTTAA
ACTACTGGTGGCTTAGTAGGAACAGGTTTAGCAGGTCAATCAAATTAAATTCCAGCTCCC
AAAAAAACTCATTAACATACTTCTTAAGCAACTGGACCAGATGAGAGATTAGAAATGGAT
ATTAATTCTGCTAAAAATCTTAATGGAAGTTTACACATGTTTTGCCAAAATATCCATAAG
TATAAACCTGAGCATGTTAAAAAATTCTTTTCTAATGAGGACATTTTCAATAAATTAACA
TAAGGTCTTCAAATATATAAAGGAGAACAAAATACAGATTAATGGGAGGTAAATTGATTT
AAAAAATATGAATTGAAGCAATTTATTAATTAGCATAAAAGTTTACTCAAATTTCTTAAT
TTGAAATACTAAAATTAGCACAATAATAAATTTAATTGGTTTATTAAAAAAAACAAGAAT
GATTTGGTTATTTTTTATTTAAAATTTTTTAATAGAATATAAAAAAGGAAGCCAAGGAAG
GAAAGACTCCTTTGAAGTTCTGGAGTGAGAGATTATCAAAATATAAATATTAGTATTTGA
TTGTTATGTTTATTGAAGATATTGCTGAATATCTTTAAATTAAACCTATGGATTGTTACC
GTATGTTTGATGTTTTCCTTTCTCACGAGAGCAAATTTGTCGACTATTTCTTCAATCCTT
CTTCTAATGAACCTTGCATCGAATTTTTCTACGAATAACAAGCTATTTTATTTGAATCTA
ACAATGTTGCAGTAAGAAAGGACTCTCCATTTATAATTAATTTGAAAACTTCTTTTATGA
AAGACATTTATTTCCATGAACGTAACTGCATACTTGCCTCCCTCCGTCTTCTTTTACTTT
TCACTGATGGTATAACAATTAAAAATTTAATAATTTAATCTCATTATTTAACAAATATTA
TTTTAAGACCAATACAATTACGATGCTGTTAGAGATGTTGTCGCTCGTCTCTTAAGAAAC
AAATTAGAAGAGTCTTTATGGGAATAATATGCTGGATAAAACAATAATCCTGAATTAAGT
GCAGAAGATAGCGAGCTATTCTAACTTTAAAAATAATTTGAAAACGACTAAATCATTAAG
CTTTTATTCATTATCACTTAAAAAAATCAAAGCAAAATTAGCATAGAAACCTATTTACAA
AAATTCAATAGCTAAAACTTCATGGGTAATTGGTAAAATTTACAACCTCAAAATGAAAAC
ACCTTTGAAAATAAAAATAAAATTAACGAGTTATCAACAGTAGTTGGTGATTCTTGTTTG
ATGTTAGTATTTGCTAAAGTAAAAGAAATTTAATAAAATAAAAACAAAAATGAAAAAGAT
GCATTTGAAAAGATATTTAAACAATCTTAAACTAGCTCTTAGAAGAGCTAATAAATGAAT
GTTTTAAAGCTTTACTATGACTCTATAAGCTAAGAATAATTGGTTGTTGAATTTTATGAA
TAAATTGAATATCTCTACAAAACTATTGTTAGAATTCTTAATTATAAGAATTTGGGAACT
CTCAAAACTTAATGGTAGGAAATATTCTTTGAATTGCTCGTAAAGATTATTTAAGGAATT
AACGCAAATGAATTCTATGAAGAAATGGATGAATAGCTAGAATCTTTCATTAGTGAATGC
ATTTGTATTGCATTTTCTAAAACTATACACAAAAATCCTAAATTAATTGACTTATTCTGG
GAAAAGCTCGAAAGCAGAGAACAAACTAAGCATTTCCAAAATATCTTTTCTAGTCCTATT
TCTATTTACAAAGTAATGAAAAGTGCACTAGGTATGAGCTCCGACCCTAAATCTCGTCAT
GTTATCATCTTTTTGACTACTTTAAGCAATTTTAATTGGATTAACTTTAACTAAATAGCT
GACTCACAGTAATAAATATTTATTTAATTTATTAATTATTTAATTTAATTTGTTTTTGAA
TAGATAAAATTTAGATACTGCAAGCATATTAAAATTGAGATTAATTTATAAGCTTATAAT
TACTGATCCTAAATGCATTAATTTACTTTAATATGTATTTTACTTCACTGATTTATCATA
GAATACTTTCGATTAATACATAAATGAATGCAATGGTGATGAAGTAATTAAATTTGTGAT
AAAGAGTTTTGCATTATATAACGATTTGCGTAGCTATGCTTATTAAAACTTCTTTGCTGG
TCTTAAGGCCTTAAATGTATTGCTCAACAATCACTAATACTAGACACAATAAATTTTGTA
AATCGAAGAATATTAAGATTTGCTCTTCAAAGAATATAGACGTTTAGCAATATAAAATGA
TGTGACTGCCACTGAATACAGATTAAAATGCAAGAGAGAAATCTTAAATATCTTATACAC
TATTTTAAAGGATTTCGAAGAGCCTTTGCTTGCTTTCTCTCAAATAAAAGGAATGGAAAG
AAACACAGAATATGATTCTCCTTTACTTGCTCATTTGTTCCTCTTCTTCACTAGCTTTAT
TGAAGATTGGGAATAAAACTAAGGCGCTCTTTACCTTAAGCATAAGTGGAAAATAGGTAA
TCAATTTTTATTTCGATTTTTCTTTAATTAAAAAAAAATTTTATAAAGAAATACTTTTTT
AAACTTTTTCTTCAAAAAATTCTTTTAGGCTCTTTAATCATGAAAATTACTGATATTTGT
TTAAACAGATTATCAATAAATGTCTATAAGAAACAAGACTTCAGACCTGTTTAAAGTGAT
AGCTATACTAGCTTTTTCTTACACAACTTCCTCTGCAACTAATTAAAGAAAATCAGAGTA
GATGAAATGATTATCAAGGTGCTTGAAGTAGCAGCTAACTAATCATCTATTAGTAATAAA
TAAATAAATCAACAATAAAATTTTATTCAATTAATTTTAATATCTAATAGGTAACAACAA
GATAAACAACAAAACTCTTAAATTGAATAACAAGTATTGGTAAACTTATATCATGAATAC
CTCAAATAAATTTAAAGAACACTAGGTTGAACACATTAAAAACTAAGTTAATTTAAGAAA
TCTGATTGTTGACACATTGAAGGTGTTAGAAACTACTATGCAATTAATTGAATAAAAAAT
TTAAATCCGTAAACAAGATTTCGAATATAGATTTTTACAGAAATCAATGCTTTTAGATGA
AATCCCAATTTTAGATTTCTTTGAAAGAATAATATGCAAATCTGACTGTATCTTCCATTA
CAAATAAGAATATTACATTGACTCAAGCTTAAACTCAATAAAAATAAATATTTTATACGC
CATATCCTCTTACATTAACTTTGAAAATCATTTCTACTCTTCAAACGATGAAGTTAACCC
AACACTTCCCTTTTATATTTACAATTTCTTGGAAAGTGAAGGTAATTTAATTAACTAATT
GGCAGATACTCATTACCTTCTCGACTATGACACTATTAGAAACCCATTAAATAATGTATA
TTTAAATTCTTAAAAATATAAACAATATTTTGATGAAATTATTATTTAAATAAATCTTAG
TCTCGTTTACCAAATGGTACTTACTGTGAATTGATTAGCTCTTTGAGTTTGAGAATTTTA
ACTTAAATCATGTTGGCTTGGGAAGTAAATAAATTAATTAATTTTCATTCAATTTCAAAG
TGTTTAAATTATTATATTTATTATAGGCTCAATAGTCAATTAGAAAACCTATTTTAGTAG
ATTTCTTAAGCAACATGAATATGGAAAACTACTGGGAGAAGTTAAATTACTCTTCTATTA
ACACTTAATTAACTAATTTCATAATTGAGATGTTTAACATATTGAAATTGAATGAATATG
ATTCTAACAATGATAGTGAAGCTCTCAGAAAAAACATATCAGACAACAGCTGTGCAGTTA
TCGATTTCATGCTCACTGCCTTATACACTCAACCTCTCTTCATGAACTTGATTCTTAAAC
CTGATAATCTTAACAGAAAAAAGAAAGATAATGATCTTAAAATCAGATTTAAGCGCTTCT
TTGAATCAAATGTTTGCACTTATGACATGCGTTTACTCAACAAAGTAAAATATCAAATAA
ATATTTAAAACAAATTCATCAAAATATCTTCTTTTTTTTTATAAAAGTATTTGAATCTTT
TAGTTGAAATCTTTAAGAGAGATTAAATGTACCCAAGCTTTTGTTAGGAATTCCGTTAAG
ACACACAATATATTTTCGAAAAGATTACTAAAGTCGTAGTTTAAAACTTTAAACCTTATG
AAATCGACTAGCTCGTTGAAAGAGATCTTTACTTTTTAAATTCTCCCAAAGAACCAAATA
TTCCTTACTTCGAGTTCTAAAAATTAAAGTTATCTCAATTACTTAGAGAACACATAAAAT
AAACAGAACTCTACTAATAGATGATTTGCTTACACAGTTTCTAGATTTTACTTGATTTAA
TTAGCAAAGAATATCTTTCCAATAAATGTAAATCAGTCCAATCTATCCAAAATAGCTTAA
AAGCAATATTCGAAAATAAATAAGTGTAATGAATCAATTATTTGAATTAATGTTTTTTAT
AAATTTTATAAATTAAAATATAGTAATCACATCATGAACAGCTTATCTAAGTTCGCTCCA
AGCTATTCATTAGATCTTTGGCCAGTTCCTCAATAAATTCAAACTAAGATGAACATTGAA
AATGAAGAGTAATTTAAGGGAAAAATTTTCTAATAATCTTTCTTCTATTTGTTGGAAACT
AACCAATATTCATATGGAAGAGGATATGCTTTGGATGCCAGTGAGATTATATTCAATAAA
ATAGACGCTGAAAGACCTTAAGACTACTTGTCTAGAGCTAAATACATTCTCTTTAAATTA
ATTGAATTCCGTCAAAAGAGTATTAAATGGTCTATTGAAGAAATAAAACTAAGGACATTT
GATTCATGGATTAGACTATTTTGTTTAGTTACTTCTTCAGGAGTTGAAGGTTACGCTATG
AGTACTGTACAATCTTCTATTCCAAATTTCACTCTTAAGTAGCTCAGAGAGAGAAAGATT
ATTTTAGAGCATGAATAATTATGTTTACTCTATCCTAACTATGAAATAGAGTTTGTGAGT
GGATTTGTTAACATCTTCTGTGCCTGTAAATAAATAATTTTATATTTGCATTCAATTAAA
AACTTAATTTTATTTAAATAAAAATAGCTAACCCACAATGTGTTGGTCTTTTCTCTAACT
TATAGAGCGAAATGATGAAATAAATTCTCTAAGATTTGAAAAAAGGGTACTTTGGAGTGC
TCTTTGATCAAAAACTCAAATTTTTACTTTACATATTATTCTCACTCAGACACTTACAAG
ATCTAGACTACCATTCCAAAGAGTCAGAAAATAAAAAGACATAAAATCCTAATAATTTTA
TTGGTAGATCAAACTAAAATCAAGAAAGCTAACATTCTTTCTCAGATTCTTATAAAAAAG
AAGAAGCCGAAGATTTATTCAAAGTAATGACATAAATTTTAGAAGAAGCTGTCCATCGTG
GTACTAGAGTTCAAATATGTGATTTCATTTAGGTAAAATTAAAACGCTATTAAAATTAAT
ATAAATCAATTTATTTATTTATTTACTCTCTTATTTGCTTATTTTGTTTATTTACTTTTG
CTTTTTATAAAAGTGCTTATTCTTGCAATTACAAGTGATGGAAGTTCTCTACTTATAAAC
CTTCTAAAACAACAAGAAAAAATTCGTTATCAATGAAAACTTGAATCCTTACTTTACAAA
AATAATTGGTATTTTAATGAATTTGGCTGCTTAGAATATTGATGGTCTCCCTATTTTAAT
ATCTTGTCTTAACAGTGCCCTACATATCTATCCATAATACTTTATTCTTTAATTCAAATA
TCAAGTTAAAGCTTTAGAATTTTTGATTAATAAAATCTTTTATGAAAAGGTAATACTTAT
TATTTTCATTTATTATTTGTTTGATTAACTTTTTTAACTTTAAAATTAGAATGAAACTGC
TTAAATCTTTGTTTCTATTATAAATCTGTTGACAGATATTGCTAAGTATCCTGAAGGTGC
TCTTTTATTGAGTGAAGCTAATATTGTAAGTATGATATGCAACACTCCCATTTTTAAGAA
TATAGAAAATGAACCATTCTATTGGCAAAATGGAGAAAGAAATCTCTTACATTCTTTCTG
GTGTTGGAGTTTGAATTTCTATAAGGAATATATAATTTCATTGCCTTCAGATTTAGAAAA
CACAACTTCATCTTTCTAATTCTTATAGACTTATTTCACTCGTATTGCTAAAATTCTCTC
TATTCCTCAAGTTTTATAAAACACTGCTACAAATTTAGCTAATAACAAAATGATTAACAC
TGAATAAGAAAAGCTTTCTCTTGCAGTAAAAAAATTTTTGTTTTTAAATTTTATATTAAA
ATTAAATAATTTACTTATAAATTTATTACAGTATATGGAAGAAATCGAACTTATTTTGGA
ACTTCTCTCAGTTTATTTCTGCCAAGCCAATATCTTCAAAAGAAAGATGAGCAACGATTT
TGAATAAATACTTCAATTCTTGACTCATTGCACTATTTGCTTATTTAAGTAGGGTCTTTC
CATCCAATCTATCTTCATGCCAGTTTCTAAAATGGAAAAGAAGCTCTCTCAAATTTATGA
CATTTATCAGGTCAGCTCAGCAGACAGTGCTCACTTATATCACACATCTATACTTACTCC
TTCTCATACTCCAAACAAATAAGAGTTAGAAGCAGGCATCTCTACAGCTCACTCTGCTAT
TGGAGATACAGTAAATATCTAAATAGATTAATATTAAGATTATGAGATTAATTATTATTA
TTTAAATTAATAGAAAAATAAGAACTATAACTTATTCATCATTTAAGTTGAATTACACTA
CTAGAGCATTTTATTCAGTTTGTTTTCTTGTATCTAAGACGGTTTACAAGAATCAAGTTT
ACTTTAATTATTCTAATATTCTAGCAACAGCTTCAGTGATAATTTGATCAATAATGAAAG
CAAGTAAGTTTATTCTGTAAATTACTGGTAGAGCTTTGCAAATTCTTTGTTTGACTGCCT
TAAATTCGTAGAAAATACTCTAAATAAATGGGATTATAAGAAAAATAAAAATGTTAATAT
GGATGACTAGCTTGTCAAGCTTCGCGCTCTCACAAATTCTGTAGAGTATAACTTATGTTG
CTATGGATTTGGTTCTCAAACTTCTTTAATAAATAGTGCTAAAACAATTATTTAAACATC
TTAATTTAGTCTTTAAGCTATCGTTCTTTCTGCTATCAAGCACTTCTAAATGTTAAACGA
ATTCAAATAATGGTTTGGACACTCTATAAAAGACAGTTTAACTGATTTATAAAATAAATT
AAGTAATTTCTATTTATTTATTATTTTTCTTTTTATTTAATATTACCTAAAAATAGATGC
AAAGCTAGATGGATTGAAGAAACTAGAATATGAAGATATTTAACTTAAAAAATAAATTGA
AGAGCATATTTTACAATTCTAAAGGCTATCAGTGACATAAGATAGATATTGA


>TTHERM_00091620(protein)
MAANTGGGLFGGQQTQQNQGLFGGQQTQQNSSLFGGQQAQNQQQGQGAQGQQQAFSLFTN
NQQGQNNQQASSNQQNIFGGAIQQQQGGGNLFGQTQQSQQQGTGQPSGLFGGIGNMNQQP
AAKQNETPVPPQTQNQLFANIQNQQQPPQQQTQNQGQQSQQQQQQPTSTNGLFGNVQLGA
SNQNQAQNNTQNQQAEKPNSLFGDKQNQGAPQVTGGLFGNSANQGTGMQINTNKPATSGL
FGANQTDQQQNKPIGGGIFNQMQQNAQSQQTQQQQQPPTQTGGGLFGQTQQQQQTNAPPK
EEPKTSLGGLNLLGQAPLNTQNQQNQAPKQPAQSGGLFAQAPQQQQQQQQQQQQNNTQPT
TTTTIPSTNSLFNNAPNTQAGATTTQTAQTTQTAAAPPKSQGPSLFAQNNQQTAQPPANS
QPTQQGQTQGGGLFGANIDAQNAGSSQPKFLNIGANKDNILGQGKTNQPEGLNIGGGQKG
ILTGASGAAATTTTTAASTTDATKPAQPSILTGQTQAASSLLGGQQKPATNPPTIGATSQ
TTGGLVGTGLAGQSNQIPAPKKTHQHTSQATGPDERLEMDINSAKNLNGSLHMFCQNIHK
YKPEHVKKFFSNEDIFNKLTQGLQIYKGEQNTDQWENIKKEAKEGKTPLKFWSERLSKYK
YQYLIVMFIEDIAEYLQIKPMDCYRMFDVFLSHESKFVDYFFNPSSNEPCIEFFYEQQAI
LFESNNVAVRKDSPFIINLKTSFMKDIYFHERNCILASLRLLLLFTDDQYNYDAVRDVVA
RLLRNKLEESLWEQYAGQNNNPELSAEDSELFQLQKQFENDQIIKLLFIITQKNQSKISI
ETYLQKFNSQNFMGNWQNLQPQNENTFENKNKINELSTVVGDSCLMLVFAKVKEIQQNKN
KNEKDAFEKIFKQSQTSSQKSQQMNVLKLYYDSISQEQLVVEFYEQIEYLYKTIVRILNY
KNLGTLKTQWQEIFFELLVKIIQGINANEFYEEMDEQLESFISECICIAFSKTIHKNPKL
IDLFWEKLESREQTKHFQNIFSSPISIYKVMKSALGMSSDPKSRHVIIFLTTLSNFNWIN
FNQIADSQQNLDTASILKLRLIYKLIITDPKCINLLQYVFYFTDLSQNTFDQYINECNGD
EVIKFVIKSFALYNDLRSYAYQNFFAGLKALNVLLNNHQYQTQQILQIEEYQDLLFKEYR
RLAIQNDVTATEYRLKCKREILNILYTILKDFEEPLLAFSQIKGMERNTEYDSPLLAHLF
LFFTSFIEDWEQNQGALYLKHKWKIGSLIMKITDICLNRLSINVYKKQDFRPVQSDSYTS
FFLHNFLCNQLKKIRVDEMIIKVLEVAANQSSISNNKINNKTLKLNNKYWQTYIMNTSNK
FKEHQVEHIKNQVNLRNLIVDTLKVLETTMQLIEQKIQIRKQDFEYRFLQKSMLLDEIPI
LDFFERIICKSDCIFHYKQEYYIDSSLNSIKINILYAISSYINFENHFYSSNDEVNPTLP
FYIYNFLESEGNLINQLADTHYLLDYDTIRNPLNNSRLPNGTYCELISSLSLRILTQIML
AWEAQQSIRKPILVDFLSNMNMENYWEKLNYSSINTQLTNFIIEMFNILKLNEYDSNNDS
EALRKNISDNSCAVIDFMLTALYTQPLFMNLILKPDNLNRKKKDNDLKIRFKRFFESNVC
TYDMRLLNKYLNLLVEIFKRDQMYPSFCQEFRQDTQYIFEKITKVVVQNFKPYEIDQLVE
RDLYFLNSPKEPNIPYFEFQKLKLSQLLREHIKQTELYQQMICLHSFQILLDLISKEYLS
NKCKSVQSIQNSLKAIFENKQVNHIMNSLSKFAPSYSLDLWPVPQQIQTKMNIENEEQFK
GKIFQQSFFYLLETNQYSYGRGYALDASEIIFNKIDAERPQDYLSRAKYILFKLIEFRQK
SIKWSIEEIKLRTFDSWIRLFCLVTSSGVEGYAMSTVQSSIPNFTLKQLRERKIILEHEQ
LCLLYPNYEIEFVSGFVNIFCASNPQCVGLFSNLQSEMMKQILQDLKKGYFGVLFDQKLK
FLLYILFSLRHLQDLDYHSKESENKKTQNPNNFIGRSNQNQESQHSFSDSYKKEEAEDLF
KVMTQILEEAVHRGTRVQICDFIQCLFLQLQVMEVLYLQTFQNNKKKFVINENLNPYFTK
IIGILMNLAAQNIDGLPILISCLNSALHIYPQYFILQFKYQVKALEFLINKIFYEKNETA
QIFVSIINLLTDIAKYPEGALLLSEANIVSMICNTPIFKNIENEPFYWQNGERNLLHSFW
CWSLNFYKEYIISLPSDLENTTSSFQFLQTYFTRIAKILSIPQVLQNTATNLANNKMINT
EQEKLSLAYMEEIELILELLSVYFCQANIFKRKMSNDFEQILQFLTHCTICLFKQGLSIQ
SIFMPVSKMEKKLSQIYDIYQVSSADSAHLYHTSILTPSHTPNKQELEAGISTAHSAIGD
TKNKNYNLFIIQVELHYQSILFSLFSCIQDGLQESSLLQLFQYSSNSFSDNLINNESKQV
YSVNYWQSFANSLFDCLKFVENTLNKWDYKKNKNVNMDDQLVKLRALTNSVEYNLCCYGF
GSQTSLINSAKTIIQTSQFSLQAIVLSAIKHFQMLNEFKQWFGHSIKDSLTDLQNKLNAK
LDGLKKLEYEDIQLKKQIEEHILQFQRLSVTQDRY