Identifiers and Description

Gene Model Identifier

TTHERM_00092850

Standard Name

MCM3 (DNA replication licensing factor MCM3)

Aliases

PreTt16539 | 6.m00613 | 3836.m02199

Description

MCM3 DNA replication licensing factor MCM4; Component of the Mcm2-7 complex involved in DNA replication

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • heparan sulfate N-acetylglucosaminyltransferase activity (IEA) | GO:0042328

Biological Process

Domains

  • ( PF00493 ) MCM2/3/5 family
  • ( PF01078 ) Magnesium chelatase, subunit ChlI
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_18847 0
Description: None
Tetrahymena borealis EI9_02544.1 9.997093137033517e-262
Description: MCM2/3/5 family protein (861 aa)
DictyBase DDB_G0280309 9.997093137033517e-262
Description: mcm3 on chromosome: 3 position 3235987 to 3238812
Oxytricha Contig14518.0.0.g115 9.997093137033517e-262
Description: hypothetical protein
WormBase WBGene00003155 9.999763672313033e-177
Description: locus:mcm-3 status:Confirmed UniProt:Q9XVR7 protein_id:CAB02770.1
SGD YEL032W 7.002698837743091e-168
Description: MCM3 Protein involved in DNA replication; component of the Mcm2-7 hexameric complex that binds chromatin as a part of the pre-replicative complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00092850(coding)
ATGGAAATAGAAAATACTAATCAAATTGACACTCGCTGGTAAGAGCACCAGAACTTCTTT
GGACAATATTTAGCAAACTCCACTAATACAGATGCCATTAATAGAATGTTAACCAATAAT
GAGACACGTTTAGTGATCAATTTAGATGATATTCGTTAGAATCACAACCCTTAAATAGCT
GATGATATCATTAGTTACCCTTAAAAGGCAATCTCTGCCCTTAGAGGAACTCTCAATAAA
ATTATCGATAATATTGACCATGACGGGCTTGTGAAAAAGAAAAAGATGTAAGATATCACT
GAAAAAGTTAAAGTTTATCAAATTGCTTTTAATGGAAATATGGGTAGAAACCATGTAACT
CCTAGAGGTTTGAACTGTTCACTCATAAATAAATTAGTTTGCATCGATGGTATTGTAACT
AGAATGTCAGTCAATAGATCAAAGTTAATTAGAAGTGTCCATTATTGTGAAGAAATATTG
CAAGGTGGTCCTATTAAAGATTACGAAGATGTTTATGATTTAGGTGCCACAACATCTCTT
AATCCAAATAATACAATTCCCAAAAGTCATGAACAACATCCCTTAAGCTTAGAGTATGGC
TATTCTAAATTCAAAGACTTCTAGACTATTATTGTTTAGGAACTTCCTGAAAATGCCCCT
AATGGTTTATTACCTCGTAGCATTGATGTTGTGCTTGAAGAAGATTTAGTTGGATCAGTT
AAACCTGGAGATAGAGTTAGAATTTATGGTGTTTATAAATGCATTAAAAGTGAATAAACC
AAATCAACTGGTATTATGAGAAGTGTCTTAGTTTGCACAAGCATTGGCTAACTTTCATAA
GAAAATGATGATGTTTAATTGACAACTGAAGATCTTTAATATATTAAGAAAATCTCAAAG
AGAAAAGATCTCGTTGATATTTTTGTTAACTCAATTGCTCCTTCTATTTATGGACACCAA
TAAATCAAAAAGGCATTGTTGCTCTAATTACTTGGTGGTACTGAAAAAACTGTTGGACAA
GGTACTCACTTAAGAGGTGATATAAATATCATGATGATTGGTGATCCTTCAACTGCAAAA
TCCCAAGTTCTTCGTTACATGCTTGCTACTGCCCCATTAGCTTTAAACACTACTGGTCGT
GGTTCTTCAGGTGTTGGTCTTACTGCTGCTGTTAAAACCGATAGAGAAACAGGCGAAAGA
CATTTGGAAGCTGGTGCAATGGTGTTAGCTGATAAGGGTGTTGTCTGTATTGATGAATTT
GATAAGATGAGTGAAGAAGATAGAGTTGCTATCCACGAAGTTATGGAATAATAAACTGTT
ACTATTGCAAAAGCAGGTATTCACTGCAGTTTAAATGCTCGTTGTTCTGTCCTTGCTGCT
GCTAATCCCATTTACGGAGAATATCATAGAGACTAGACTCCCACTAAGAATATTGGTTTA
CCTGATTCTCTTCTTTCTCGTTTTGATTTGTTATTCATCGTCCTTGATGAAAAGGATCCC
GATATTGATCGTCTTATTGCTGAACGTGTTACTCGTAACCATCGTTATCGTCCCGAAAAC
TACGAAATTATAAACTAGCTATCCCAATTCTAAGGTGACGAAAATGATGAATACATAATA
GAACCCACTGTAGCAGGAGACGCCAACGAAAACAAAGCTATCTTTGAAAAATATAACAAA
GTTTTACATGGAGATAAAAAGAAAGAAATATTAAACTAAAATTTCTTAAAAAAATACATT
GCTTATGCCAAAAAGACATTTAACTCTCCCAAATTATCTGATGAGTCCATCGAATATATT
AACTTGTATTACAATTAATTGAGATAAAAGAACTTCTAGGATTCTACTACTAACGGTGGT
GTTAAGGTTCTTCCAGTAACAACAAGAACTCTTGAAACTGTTATCAGATTGGCAACTGCA
TCTGCTAAACTTCGTTTATCTAAAAATATTGAAATTTCTGATTGCAGACTTGCTACTTCT
CTTCTTAACTATGCTCTTTTCAATAAAGAAGATGCAATTAGACCTGAGGAAGAAGAATTT
TATGAAGAAGACGAAGATTACAAATAAGATAGAAGACAAAATGGCAATAAAAAGGAAACC
TAACCAAAATCAGTTAAAAAGTAGACTAACACAACTGTTCAACCTCCAGTCCAGGTCACT
GAAAACAAAAGAGAAAGCAGAAGTGCTTCTAAAGCTATTGCTGCTGAATAACAAGCATAA
AAATCTACTACCCCCTTAAAGGAAAAACAAGATAAAAGAGAAATCAAAAATCAAATGAAG
AAAATAAGAATCGATGACGATGATGATGTTGATAAGGTTTTCAGCTAATAAATAATTGCT
TCAATTAAAATTACTGATGAATAGAAAAAGGCTATCTTCAAAATAGTATCTAAGCTTGCT
AAGGATAAAAGTATTACCAAGGATCAATTATGGAAACACATTTAAGGTAATTAAGACTTG
TCTAAGATTATTACCAGTTCGCCTATTTTAGACAGAGCCATTATAGAATTACAAGATGAT
GAAAAGATTTTCTACGATGCATCTAAATAAGAAATCTACCCTTATTGA


>TTHERM_00092850(gene)
ATGGAAATAGAAAATACTAATCAAATTGACACTCGCTGGTAAGAGCACCAGAACTTCTTT
GGACAATATTTAGCAAACTCCACTAATACAGATGCCATTAATAGAATGTTAACCAATAAT
GAGACACGTTTAGTGATCAATTTAGATGATATTCGTTAGAATCACAACCCTTAAATAGCT
GATGATATCATTAGTTACCCTTAAAAGGCAATCTCTGCCCTTAGAGGAACTCTCAATAAA
ATTATCGATAATATTGACCATGACGGGCTTGTGAAAAAGTAATTTTATTAGTTTTTATTT
ACTTTTAAATGTGTTTACTAATTTTATAGAAGATTTGATTTATTCATTTTTGTTTTCTTT
AAACCTTGATGCATTCAAAAAAGAAATAATGAATCTGAATTTCTAACTTTTTTTTGTTCA
TAATAGGAAAAAGATGTAAGATATCACTGAAAAAGTTAAAGTTTATCAAATTGCTTTTAA
TGGAAATATGGGTAGAAACCATGTAACTCCTAGAGGTTTGAACTGTTCACTCATAAATAA
ATTAGTTTGCATCGATGGTATTGTAACTAGAATGTCAGTCAATAGATCAAAGTTAATTAG
AAGTGTCCATTATTGTGAAGAAATATTGCAAGGTGGTCCTATTAAAGATTACGAAGATGT
TTATGATTTAGGTGCCACAACATCTCTTAATCCAAATAATACAATTCCCAAAAGTCATGA
ACAACATCCCTTAAGCTTAGAGTATGGCTATTCTAAATTCAAAGACTTCTAGACTATTAT
TGTTTAGGAACTTCCTGAAAATGCCCCTAATGTAATTTTTTATTTGAATTTAAATTTTAA
GATAGATTTTGTTTTGAATTTGTTTGAATTTTATATATATGCTTACCATGTACTTAAAAT
AAAAAGGGTTTATTACCTCGTAGCATTGATGTTGTGCTTGAAGAAGATTTAGTTGGATCA
GTTAAACCTGGAGATAGAGTTAGAATTTATGGTGTTTATAAATGCATTAAAAGTGAATAA
ACCAAATCAACTGGTATTATGAGAAGTGTCTTAGTTTGCACAAGCATTGGCTAACTTTCA
TAAGAAAATGATGATGTTTAATTGACAACTGAAGATCTTTAATATATTAAGAAAATCTCA
AAGAGAAAAGATCTCGTTGATATTTTTGTTAACTCAATTGCTCCTTCTATTTATGGACAC
CAATAAATCAAAAAGGCATTGTTGCTCTAATTACTTGGTGGTACTGAAAAAACTGTTGGA
CAAGGTACTCACTTAAGAGGTGATATAAATATCATGATGATTGGTGATCCTTCAACTGCA
AAATCCCAAGTTCTTCGTTACATGCTTGCTACTGCCCCATTAGCTTTAAACACTACTGGT
CGTGGTTCTTCAGGTGTTGGTCTTACTGCTGCTGTTAAAACCGATAGAGAAACAGGTATA
TATTCATCTTTAAATTTCTTATCAAAAATCTAAAATAGAATAAAAAGGAAAAAGCAAAGA
TTCAAAAAAATTTGCAAAAAAATTCTATTTAAAAATTATCAATCAAAAATATATTTTTGT
TAATAAATTATTTTTGTAAATAGGCGAAAGACATTTGGAAGCTGGTGCAATGGTGTTAGC
TGATAAGGGTGTTGTCTGTATTGATGAATTTGATAAGATGAGTGAAGAAGATAGAGTTGC
TATCCACGAAGTTATGGAATAATAAACTGTTACTATTGCAAAAGCAGGTATTCACTGCAG
TTTAAATGCTCGTTGTTCTGTCCTTGCTGCTGCTAATCCCATTTACGGAGAATATCATAG
AGACTAGACTCCCACTAAGAATATTGGTTTACCTGATTCTCTTCTTTCTCGTTTTGATTT
GTTATTCATCGTCCTTGATGAAAAGGATCCCGATATTGATCGTCTTATTGCTGAACGTGT
TACTCGTAACCATCGTTATCGTCCCGAAAACTACGAAATTATAAACTAGCTATCCCAATT
CTAAGGTGACGAAAATGATGAATACATAATAGAACCCACTGTAGCAGGAGACGCCAACGA
AAACAAAGCTATCTTTGAAAAATATAACAAAGTTTTACATGGAGATAAAAAGAAAGAAAT
ATTAAACTAAAATTTCTTAAAAAAATACATTGCTTATGCCAAAAAGACATTTAACTCTCC
CAAATTATCTGATGAGTCCATCGAATATATTAACTTGTATTACAATTAATTGAGATAAAA
GAACTTCTAGGATTCTACTACTAACGGTGGTGTTAAGGTTCTTCCAGTAACAACAAGAAC
TCTTGAAACTGTTATCAGATTGGCAACTGCATCTGCTAAACTTCGTTTATCTAAAAATAT
TGAAATTTCTGATTGCAGACTTGCTACTTCTCTTCTTAACTATGCTCTTTTCAATAAAGA
AGATGCAATTAGACCTGAGGAAGAAGAATTTTATGAAGAAGACGAAGATTACAAATAAGA
TAGAAGACAAAATGGCAATAAAAAGGAAACCTAACCAAAATCAGTTAAAAAGTAGACTAA
CACAACTGTTCAACCTCCAGTCCAGGTCACTGAAAACAAAAGAGAAAGCAGAAGTGCTTC
TAAAGCTATTGCTGCTGAATAACAAGCATAAAAATCTACTACCCCCTTAAAGGAAAAACA
AGATAAAAGAGAAATCAAAAATCAAATGAAGAAAATAAGAATCGATGACGATGATGATGT
TGATAAGGTTTTCAGCTAATAAATAATTGCTTCAATTAAAATTACTGATGAATAGAAAAA
GGCTATCTTCAAAATAGTATCTAAGCTTGCTAAGGATAAAAGTATTACCAAGGATCAATT
ATGGAAACACATTTAAGGTAATTAAGACTTGTCTAAGATTATTACCAGTTCGCCTATTTT
AGACAGAGCCATTATAGAATTACAAGATGATGAAAAGATTTTCTACGATGCATCTAAATA
AGAAATCTACCCTTATTGA


>TTHERM_00092850(protein)
MEIENTNQIDTRWQEHQNFFGQYLANSTNTDAINRMLTNNETRLVINLDDIRQNHNPQIA
DDIISYPQKAISALRGTLNKIIDNIDHDGLVKKKKMQDITEKVKVYQIAFNGNMGRNHVT
PRGLNCSLINKLVCIDGIVTRMSVNRSKLIRSVHYCEEILQGGPIKDYEDVYDLGATTSL
NPNNTIPKSHEQHPLSLEYGYSKFKDFQTIIVQELPENAPNGLLPRSIDVVLEEDLVGSV
KPGDRVRIYGVYKCIKSEQTKSTGIMRSVLVCTSIGQLSQENDDVQLTTEDLQYIKKISK
RKDLVDIFVNSIAPSIYGHQQIKKALLLQLLGGTEKTVGQGTHLRGDINIMMIGDPSTAK
SQVLRYMLATAPLALNTTGRGSSGVGLTAAVKTDRETGERHLEAGAMVLADKGVVCIDEF
DKMSEEDRVAIHEVMEQQTVTIAKAGIHCSLNARCSVLAAANPIYGEYHRDQTPTKNIGL
PDSLLSRFDLLFIVLDEKDPDIDRLIAERVTRNHRYRPENYEIINQLSQFQGDENDEYII
EPTVAGDANENKAIFEKYNKVLHGDKKKEILNQNFLKKYIAYAKKTFNSPKLSDESIEYI
NLYYNQLRQKNFQDSTTNGGVKVLPVTTRTLETVIRLATASAKLRLSKNIEISDCRLATS
LLNYALFNKEDAIRPEEEEFYEEDEDYKQDRRQNGNKKETQPKSVKKQTNTTVQPPVQVT
ENKRESRSASKAIAAEQQAQKSTTPLKEKQDKREIKNQMKKIRIDDDDDVDKVFSQQIIA
SIKITDEQKKAIFKIVSKLAKDKSITKDQLWKHIQGNQDLSKIITSSPILDRAIIELQDD
EKIFYDASKQEIYPY