Identifiers and Description

Gene Model Identifier

TTHERM_00094210

Standard Name

RPC5 (RNA polymerases I and III subunit 5)

Aliases

PreTt16576 | 6.m00650 | 3836.m02233

Description

RPC5 DNA-directed RNA polymerase I and III subunit RPAC1; Fifth largest subunit of RNA polymerases I and III; homolog of RPC40 in yeasts and RPA40 in humans; expressed in macronucleus of vegetative cells and weakly in early stages of conjugation

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01000 ) DNA-directed RNA polymerase, alpha subunit,
  • ( PF01193 ) RNA polymerase Rpb3/Rpb11 dimerisation domain

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD02176 ) Macronucleus: HA tagged RPC5
  • ( SD02718 ) Macronucleus: HA tagged RPC5

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02582.1 9.997093137033517e-262
Description: DNA-directed RNA polymerase I polypeptide (340 aa)
Oxytricha Contig22041.0.g30 9.995094197784295e-101
Description: RNA polymerase Rpb3/RpoA insert domain
DictyBase DDB_G0282339 8.003693242657371e-87
Description: rpa5 on chromosome: 3 position 5656917 to 5658092
WormBase WBGene00019275 2.0004485223439647e-69
Description: locus:rpac-40 status:Confirmed UniProt:Q9UAY9 protein_id:CCD68663.1
SGD YPR110C 3.0000115468388957e-66
Description: RPC40 RNA polymerase subunit AC40, common to RNA polymerase I and III
Stentor Coeruleus SteCoe_7522 3.0144087850653746e-40
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15470252: Mochizuki K, Gorovsky MA (2004) RNA polymerase II localizes in Tetrahymena thermophila meiotic micronuclei when micronuclear transcription associated with genome rearrangement occurs. Eukaryotic cell 3(5):1233-40

Sequences

>TTHERM_00094210(coding)
ATGTCAAATAAAACTTAAAAAATGAAGAAAAATATTGTCTTCACCAACGAAGGCATTCAA
CACAGCTAGGAAATGAACTATAGCGCTGCTTTTACTAGTGAAGAAGATTTCAATACATTC
AAGGAAAACATTAAAATAGAAGTTATTAGATATGATAATAAAAATAAAGAATTAGAATTT
GATTTAATGGGTGTCGATGCTCCTATTGCTAACGCTTTGAGAAGAATTATGATTGCAGAA
GTTCCTACAATGGCTATCCACAAGGTTTATATTTACTAAAATACTTCTATTATTCCTGAT
GAAGTTTTGGCTCACAGACTTGGTTTAATTCCTATTTATGCTGACCCTCGTCTTTTCGAA
GAAAAGCAAGAAGAAGACGAGTATAATGAAAAAAATTCTTTAAAGTTTACATTAAAGATT
AAATGCTCTAAGAAAGAATAGTACAAAAATTACTCTGAAGCTGATTTAGAAAATTTAACA
CCTGAAACCTACTTAGAAAATGCTATTGTCTATAGCGGTGATTTCAAATGGGTTTCTTAA
GGAGAATAAAATAAAAAATTTGAAGAGAATCCAATCAGAATGGTCCATGATAATATTATT
GTAGCTAAGTTAAGAGAAAACCAAGAAATTATTTGTGAAGTTATTTGTTAAAAGGGTATT
GGAAAAACACATGCCAAATGGTCTCCTGTTTGTACTGCTTACTATCGTTTAATGCCTGAA
ATAAACATAAATAGTGATATCACCGGAGCTAAAGCTCAAGAATTGAAAGAACGTTGCCCT
CTTAAAGTTTATGATGTTTAAAATAATAAGGCTATTGTTTCTAACGAAAGAGCTTGCACT
ATGTGCAGAGAATGCATAAGAGAAGATGAAGAATTCAATTCAAAGATTGAATTGGCCAAA
AAGAAAGAGCATTTTATTTTTACTGTAGAAAGCGTTGGAATCTACGAACCTCACGAGATA
GTAAAGGAAGCAATCTAGATATTAAAATAAAAAGCATCTAGTTTTATGCTAAACCTATGA


>TTHERM_00094210(gene)
ATGTCAAATAAAACTTAAAAAATGAAGAAAAATATTGTCTTCACCAACGAAGGCATTCAA
CACGTATAGATTAAAAATCATTTTTTTATTTTAAATAAAAGTGTTCAAAGAACTAAGCAA
TTTTAGCCAATTTCATCATATTTACTAAATTAGAATCTTTAATGAAGTATTTAATCAGGA
AATCTAAAAAATGATTTCTAAATTTGATGAATTAGAAAATGAATTAACAAATTTAATCAA
ATAAAAATTCTATATCAAATTTAAATGAGCTTAAACATATTTTATCTTATCAAAAGAGCT
AGGAAATGAACTATAGCGCTGCTTTTACTAGTGAAGAAGATTTCAATACATTCAAGGAAA
ACATTAAAATAGAAGTTATTAGATATGATAATAAAAATAAAGAATTAGAATTTGATTTAA
TGGGTGTCGATGCTCCTATTGCTAACGCTTTGAGAAGAATTATGATTGCAGAAGTATATT
ATTTTTCTTTTTTTCAAATTTTTAGTTTTCTTGAGCGAAAATTATCATTAGTTTCTAAAA
TACTATTAAAAATTAATAGGTTCCTACAATGGCTATCCACAAGGTTTATATTTACTAAAA
TACTTCTATTATTCCTGATGAAGTTTTGGCTCACAGACTTGGTTTAATTCCTATTTATGC
TGACCCTCGTCTTTTCGAAGAAAAGCAAGGTAAATTCATTTTATAAAATTAAAGAAGAAG
ATTTATTTATAAACAAGATTTTATAGCAATAAAAAAGTAAAGTGGATAGATAGCTAAATT
AATTAATTCTTAATTTTTATATAAATTATTTTATTTACTGCTTTTGAATTTAATAATAAT
CAAATTTTAAATAATAAATTTAGAAGAAGACGAGTATAATGAAAAAAATTCTTTAAAGTT
TACATTAAAGATTAAATGCTCTAAGAAAGAATAGTACAAAAATTACTCTGAAGCTGATTT
AGAAAATTTAACACCTGAAACCTACTTAGAAAATGCTATTGTAAGATAAATTTTTTGATT
TAGGAAGCGAATTTTTAAATGATCTAATACATTTTAATTAGGTCTATAGCGGTGATTTCA
AATGGGTTTCTTAAGGAGAATAAAATAAAAAATTTGAAGAGAATCCAATCAGAATGGTCC
ATGATAATATTATTGTAGCTAAGTTAAGAGAAAACCAAGAAATTATTTGTGAAGTTATTT
GTTAAAAGGGTATTGGAAAAACACATGCCAAATGGTCTCCTGTTTGTACTGCTTACTATC
GTTTAATGCCTGAAATAAACATAAATAGTGATATCACCGGAGCTAAAGCTCAAGAATTGA
AAGAACGTTGCCCTCTTAAAGTTTATGATGTTTAAAGTAATTTAAAATAATTAATATTAA
ATTAACATCAGCTAATATAAATAAAACTATCTATTTTAATAGATATTTAATATTTTTTAT
TATTCTGTAAACAAATACCAAACAAGTATCAAGTCAATTTCTGATAACTAAAAATTGATT
TCTTGCTAAATTATAATTATCAAAAAATTACTTGTTTGTTAGATATAAATAAAAAGACAC
AGCTAATACAAATCAAATATTAATTATATTCTAAAATTTATTGGTCTAAAATTATGATCT
AAAAAAAATATCTAAGACTTTATATAGCTTAAAAAATTTTTTGTTTACTTAAATTAAATT
AATTTTTATAAATAGATAATAAGGCTATTGTTTCTAACGAAAGAGCTTGCACTATGTGCA
GAGAATGCATAAGAGAAGATGAAGAATTCAATTCAAAGATTGAATTGGCCAAAAAGAAAG
AGCATTTTATTTGTAAAATATTCATTATATTTAGATTAAATTGATAGGAATTTATATAAG
AAATAATAATTTTACTGATCGGAAAGGGAAGATATAGAAAAATTAATTAATTTGGATTTA
AGCTAATTTAATATATTTATTAGTTAAAATTACAATAATTACCTTATATTAATTTATATT
TTTAATATGCAAATAGTTACTGTAGAAAGCGTTGGAATCTACGAACCTCACGAGATAGTA
AAGGAAGCAATCTAGATATTAAAATAAAAAGCATCTAGTTTTATGCTAAACCTATGA


>TTHERM_00094210(protein)
MSNKTQKMKKNIVFTNEGIQHSQEMNYSAAFTSEEDFNTFKENIKIEVIRYDNKNKELEF
DLMGVDAPIANALRRIMIAEVPTMAIHKVYIYQNTSIIPDEVLAHRLGLIPIYADPRLFE
EKQEEDEYNEKNSLKFTLKIKCSKKEQYKNYSEADLENLTPETYLENAIVYSGDFKWVSQ
GEQNKKFEENPIRMVHDNIIVAKLRENQEIICEVICQKGIGKTHAKWSPVCTAYYRLMPE
ININSDITGAKAQELKERCPLKVYDVQNNKAIVSNERACTMCRECIREDEEFNSKIELAK
KKEHFIFTVESVGIYEPHEIVKEAIQILKQKASSFMLNL