Identifiers and Description

Gene Model Identifier

TTHERM_00094220

Standard Name

SIT1 (Scramblase In Tetrahymena 1)

Aliases

PreTt16577 | 6.m00651 | 3836.m02234

Description

SIT1 scramblase; Scramblase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02583.1 9.999875542736265e-136
Description: scramblase (240 aa)
WormBase WBGene00011935 0.0000000020002373268528243
Description: locus:scrm-1 status:Confirmed UniProt:O45799 protein_id:CAB04754.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00094220(coding)
ATGAGCGACTAAACCGAATTAGCCAACGCTAAGCACGTCCTTATTAAACAAAGAATTGAA
TGGTTGGAAATCATTCCTTGCTATGAAGAAGAAAACTCGTATGAAATCCACACTTGTGCC
TCCGATTTCACTTCTCCATCTTAAAATCCTATTGCTACCGTCATTGAAAAGCGTGGAAGT
CTTTGCTGTCTCTTCTGCTGCAAAGCTTTCAGAGAATACGAAAATGAATATCAACACTCA
GGTCTCACTGTTGCTACCTCTCACCGTCCTTACAAGATCCCTATCTGCCAATATGCTTTC
ATTCCTTTGTGCAAACCTGAAATTGATGTCCAAAGAGGTGGTTAACACATTGGTAAGGCT
GAATGGCCTTGCTGGCATCCTTGCTGGCCTGCTAGAGGTTTATTGAGTTGCCAAGAATTC
GATATTAAGGACGCTTAAGGTAACATTATCTACAATATTACTGCTAACTGCCTCTAACTT
GGTTTCATCTGCCCTGTTCTTGGTATCCTTGAACCATGCAAGACTAGGGAATATGAAATC
AGAAATGCTGATAAGGTTGTTGTTGGTAAGATCGTAAATATCTACAATGGTATCCTTGAA
GAATGCTGCACTAGAGCTGATTAGTTCGGTATTTAATTCCCTGATGACTGCACTGTTGAA
CAAAAGCTCCTTATCATTGAAACCGCTGTTTTCCTTGATTACCTCTAATATTGGGCTTGA


>TTHERM_00094220(gene)
ATGAGCGACTAAACCGAATTAGCCAACGCTAAGCACGTCCTTATTAAACAAAGAATTGAA
TGGTTGGAAATCATTCCTTGCTATGAAGAAGAAAACTCGTACTTGATTACTTTATTCATT
TATCAAATAACTTTTATTAAAATAATCATAATAATCAATACTATGTCCCTCATAAAATAT
CATCAAACATATTAGCCAGCACTTAAAATTTGTTTTTTACTGGGATTTTAACTAAAAAAT
TTATAATACCTGATATATTTTTAATAAAATGAAAGAATTATCTTCTAAATAAAATACTTT
ATAATAAAAAAGGTATGAAATCCACACTTGTGCCTCCGATTTCACTTCTCCATCTTAAAA
TCCTATTGCTACCGTCATTGAAAAGCGTGGAAGTCTTTGCTGTCTCTTCTGCTGCAAAGC
TTTCAGAGAATACGAAAATGAATATCAACACTCAGGTCTCACTGTTGCTACCTCTCACCG
TCCTTACAAGTAAAATATTTAATATGAGTTTATCTATTATTTTATAATATAATACTCTCT
TACTTTAATTTTTAATAAAGACTTATCATCTAATACCATATTTTTTTTAACAAAATAGGA
TCCCTATCTGCCAATATGCTTTCATTCCTTTGTGCAAACCTGAAATTGATGTCCAAAGAG
GTGGTTAACACATTGGTAAGGCTGAATGGCCTTGCTGGCATCCTTGCTGGCCTGGTAATT
ATTTAATTATATATTAATGAAAAATACTATTATAACAAAATACCAAATCAACTTACAATT
AAACAAATAATCTTATCCAATATATGAATTTTTTAATTTGTCATTGCTTCTGAATAGAAG
TTATCTCAGTTGATGTTATAATACCTTTTGCTACTGCAAAAGCTTACATTATTCTTAAAA
TAAAAAACATAAACTAAATTTAATTTATAATATAAATAGCTAGAGGTTTATTGAGTTGCC
AAGAATTCGATATTAAGGACGCTTAAGGTAACATTATCTACAATATTACTGCTAACTGCC
TCTAACTTGGTTTCATCTGCCCTGTTCTTGGTATCCTTGAACCATGCAAGACTAGGGAAT
ATGAAATCAGAAATGCTGATAAGGTTGTTGTTGGTAAGATCGTAAATATCTACAATGGTA
TCCTTGAAGAATGCTGCACTAGAGCTGATTAGTTCGGTATTTAATTCCCTGATGACTGCA
CTGTTGAACAAAAGCTCCTTATCATTGAAACCGCTGTTTTCCTTGATTACCTCTAATATT
GGGCTTGA


>TTHERM_00094220(protein)
MSDQTELANAKHVLIKQRIEWLEIIPCYEEENSYEIHTCASDFTSPSQNPIATVIEKRGS
LCCLFCCKAFREYENEYQHSGLTVATSHRPYKIPICQYAFIPLCKPEIDVQRGGQHIGKA
EWPCWHPCWPARGLLSCQEFDIKDAQGNIIYNITANCLQLGFICPVLGILEPCKTREYEI
RNADKVVVGKIVNIYNGILEECCTRADQFGIQFPDDCTVEQKLLIIETAVFLDYLQYWA