Identifiers and Description

Gene Model Identifier

TTHERM_00095500

Standard Name

NOT1 (CCR4-Not complex component, Not1)

Aliases

PreTt22849 | 7.m00298

Description

NOT1 CCR4-NOT transcription complex subunit 1; CCR4-Not complex component- Not1 family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00255.1 9.997093137033517e-262
Description: CCR4-Not complex component, Not1 family protein (2467 aa)
Oxytricha Contig14324.0.g26 1.0003926095686843e-81
Description: CCR4-Not complex component, Not1
DictyBase DDB_G0276029 2.9987037581344066e-55
Description: DDB_G0276029 on chromosome: 2 position 6435703 to 6443825
WormBase WBGene00002845 9.996696112986116e-50
Description: locus:let-711 status:Confirmed UniProt:Q20937 protein_id:CCD70321.2
SGD YCR093W 1.9991939848149086e-44
Description: CDC39 Component of the CCR4-NOT complex, which has multiple roles in regulating mRNA levels including regulation of transcription and destabilizing mRNAs by deadenylation; basal transcription factor
Stentor Coeruleus SteCoe_14285 7.281290178321643e-33
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00095500(coding)
ATGAAGAAAGAACTGGGTTAGAGCCAAGCTAACCAGTTCCTCAACAGAAGCGGAAATTCC
AATCAGCAATAGGGTTAAGGAAACGTTGCATCTCCCAACCTTCCTTAATTCATATAGATT
AAGAATTGGGTTGCTTAGCTCAATAACAAGAAGATTCTTAGAGCATAGAGGAACGACATT
ATGAATATAGTACAATAACTAGGATCAGAAGGAAATTAGTATTTGTTGGAATGCCTTTTA
GAAAGTTTGGATATGAACTCACAGAATTCCCAAAATAAGGCAAATTTGCACACCACAGTT
AAAGGCTAATTTTTGAGCCAACATTTGCATGATTTAATATTCAGCAATAGCTTCTCAAAT
TTTCTTGATTTCATGCCCAACGTCTTCATTAAAGTAGTTTGTGGACCTAATAGTTTTTCA
AATTAAACCAATACAAAGCAGCTAAATTAAGTGGTAAATTATGCTTAAGAACTGAGCAAG
TGCCTCAAAATGAATCCTGTTGATTAGCTTTTCATAGCCTTAAGCTTTGCATGTTGCAAC
AACGAAACAGTAGCATCAGAAGGTGTTAAGCTTCTCAGAGAAAAAATTATTGATTTTGTT
TAGTAGCAAAATTAAATTGCTTTGCCTCAAAATAACCTTCCAATTATTTTATTACAATTT
GTTTTGCAAAACCCTGAATTAAAGAATATGTCCCAAGAGATTCTTCAATTAAAGCAAATA
CTCAATGATCCTAAAAATAAAGAAATCAAACCATTAATTTATGGTAGAGATAATATCGAT
GATGAAGGTAACAGCTAAGAAAGTGATGAAATATAAGACCCTGATTTACATAAAGAAATA
AACTATCCTAAGCCAGAAGAGTTAAACCACATAATAGGACCAGCTGACATTCTTAAAGAT
TTAGGCCCAAGTGCACTATCTTCGATGGATAACTTAGTTAGAAGTTTATCATAATTTTAA
AAATGGAGCAATTCTGATGTTTACCTCTCTCTCGAATTGATAGCATAAGACCCTGTTTAA
TTAGGTGATGAATAAACTCAGCGTTTAGCTAACAATATTCTCCAAGTTGAATCCAAAAAC
AGTTAACAAGAATGGGGTAATTTCACTAATTAAGATTAATCAGATAAAAACTAATAAAGC
GATTGGAATGCTGAGTTATTTATTGAATTCCTAATGAAGAAGATATTCCCTCAAAACAAT
GAATTAAATTGGGTTTCCGTATTGACAGAAATTGATAGACCTTATTTGAAATTGAAGGAC
GAAAAATCTTTTAAATAATTCTTTACTAATATGCTATTAATTCACAAAAAAGCTCCATTT
TAAATGCCTGCATATTTGTTACTCAAGCCTTGGAAGAATATTAGAAGCCAAGCCTTATTC
TTAAAGAATATGCTAGCTGTTGGTTCTTCTGAATTAGTAAGATGGAACGAAATTTAAAAA
AATCCTATGAATTTAGAATTCAATCCATAATATAAATATAACACACTACCTTCTCCTATG
CAGTTCTGGGCCTGCTTGGATTTCCTCGATTTATTGTGTGAAATTAGTGAAGGAGATAAC
TATATGGCTATCCATGAGTTATTTGAGCTTCCTATTGCAAAATATCCAGATATCTTAATA
GTCGCTTTATCTTAACTGCATCCTAAAAAAGGTGCAAATCTCTTAGATGAAGTATTCAGT
CAACTATTTCCTAATTATTTGTCGAATCACATAAATTCTGTAGCTATTTTAGAAGCAATT
TGGAAGAATAGAGAGGATTTGCTTATTTCTGCTATTAGCGAACTTTATAGAAAAGAAAAC
AAGAAAGAAAACACATCTTTGAATTTATCAAGAGTCCTTGATATTTCCTAATATCTAAAA
GACTCTTTAATTGCTCTCACAAATAGTAACAACTACTCTTTTTCTGTATCACTTGGTATT
TTAGCTGGTAAGAGAGAATTCCTACACTTTGACTAATGGCTAAATGAGCGTGTTAAGACT
ATTGGGGATCCATTTGTAAATGCTCTACTAGCATATATCGAAGACAATGTTATTAATCCA
ATTAAAGAAATAAATATGAGACTAAACAACCCCAACAATTAAGCTTAACAGTAATATGAA
GGTGTTTTAGAAAAGGCCTAACTAACTATTGAACTACTGACTATTATTTTTGAATCTCTT
CTATTAGAGTAACACCCTGAAAAACTTACTAGCAAAAATCGTTAAAAGTTGTAAGATCAA
TATAAAGAAATATTGTAATATTTCCCCTAATTAAGTGGAACTTCGGATTCACCAGGACAA
GCTACAGAAAAAAAAGCCAATTACAATTACCAAAGATTTTATATGAGAGAAATAACAATA
GAGGAAATGATTGCAAATTTAAAATAATTAATGAATTCCAACAACTCTGAAGACAAAGAA
GTGTTTGCATGCATGATCACAAGCTTGATTGAAGAAGCTAAATACCACTAGTAATACCCC
ATAGCTGAGCTTCTTTTAACAGGCTAACTCCAAGGAAGCATCATAAATGCACAACTTGTC
AACTAGAAACCATTAGGCATTATGCTAGAATAAATTTTGGAATCATCAAAAAAGACACAG
AGATAAGTTGAGTAATCAGTAAAAGCAATAGAAGCTATGAAAGATCGCCTTCATGAATTC
CCTTACTTTGTAAATGCTCTTTTCGACCCATCCTGCCATCTTTCTGAGCAATTTCCTCAA
CTTCTAATTAATATTTATAATATTATGATTGAGAAGAAGGTATAAATTAATGTAACTAGT
AAGCAAATTGAATAGCTTAAATAAAGAGTAGAATCCCTTAAAAATGAAGCAAACAAACCA
TCTCAAACTTACTAGGCAACAACAACTTAACAAAAGAAGATCTTAAAGTTAAGAGGAGAA
GTAGAAACTTCATCTGAAAATACCTCCTAACAACAATAAAATCAACAAGCATAGAACTAA
GCTGCTGCTGTAGCTCAATCTGATTAATCATCAGCACAGCCATAAGCATAAAATTAATAA
TAGTAATAACCATTATAGCAATAGGAAGGAAGTGCTTAGACAAAATAACAACAAGAATAA
GATACTAAAGCAAAAGCTGATTAGAATAACTAGCCTAGAAATCCTAGTGTTTAAAATGTA
AGCTAATAAAATTTAGGTGAAGAAAAATAACCTTCTGATAACACCACACAAAGTAAAGGT
AAAACTAAAAAGCCTCTTTTTGCTGGATCTTCCGTATTTCCTTTGAGCAATTTAACTGCA
AACTAACCAAAAATGGTATTCGAAAATCCTATTAATCAATAGATGAGATTCTAAGATACT
TAAATAGGAATGTATGACCAAGGATTGTATAATAATAATAATAATAGCACTAATAATAAC
AATAATGGCAATAATACAGAAGAGATAGTTGTAAAAGCAAGACCTTACTAAGGAGGTGTT
GGTTTTGTTTAAAGACCTATATTTACAAACGGTGAACAATAAATCTATGCTTCTAAATCT
ATTAATGAAATTTTAGAATATGAAAACTCACTTTAAATAGATGAATCAACAAAGATGAGA
GTTAATTTTGCACTAAATAATTTATCAGATGGAAACATAGAGAAACACTAAAATGATTTT
AGAAATTACGCAGAAAATGAAAATTTTTAGAAATGGTTTGCTAGGCATCTTGTCACTCAA
AGAGCTACTTTGAAATCAGAAATTAATGTCTTGCTGTACACTAAGCTCTGTGAAAGAATA
GATAAGCCTAAACTCTTTTCCTTTATCATAAAAGATTCTTTGTTACTTTTGCACAAACTT
CTCTTATCAGAAGCTGCCATTCATGCTTCTATCCGTATTACCACTCTTAAAAATCTAGCT
CATTGGATAGGCATGTTTACTTTGAATCGTAACAAACCAATCAATTCAAAATATTTGAAT
ATCAAGGCATTAATTGTCAATTCTTATCCGAACAAAGTTGATGTAATTATTCCTATTGTT
ATCAACATTCTACTTTGCTGTAAAGAATCAAAGATTTTTAATCCTTAAACTAACCGCTGG
GTCAAGCGTATTCTTTCTCTCTTAGAAGAATTCAAAAATGTGGTTCAGAAGGAAACTGTC
AAGCATCAAATTAATCAGTTGTTCTCTAATTTATAAATTGACGTAAATAGTTTAGAACCT
TGTACCTACTTTAGATACTACTTACAAGAAAGTAAAAAGGAAGCTAAGCCAGCTTAATAG
CCTGCTACTATTGTTTCTTTTTGCATCCGTGATAGACTAATAATTACAGATGATCTTCGC
AACCTGTGCAATATTTAAAACTTTGACTTAAAGTAAGCAGTTTTCCAATCCTTAGACGAA
GCAATCATGGAAATTATACAACCAGTAATTTCTCGTAGTGTTACTATTGCCTTAGTCACC
ACTCGTGAATTAGTCTTAAAAGATCACTGCACTGATCCTGATGAGAACAATCTTATAAAT
GGCATCTCTAACATGGTTTAAAAACTATCTGGCTGTCTTGCTTTAATCACCTGCAAAGAT
CCACTCAGATCAAGCTTCCAAACCCACTTAAAGACTAATTTAGAAAAAGTGACTGAATTA
AATGCCAACGAAAAGGAATAAATCATTAATAAGGTAGTTATCGATAACATTGATATTGGC
TGCCAAGAAATCCGCTAAAGAGTAATGGATTAAGCTCTTAAGGAAATAAAATAAGATGAT
GCTATCCTTGAAGCTATTGAAATGAGAAGAGCCGCAAAAGAAAAGTAGTAAGTATTTGTT
GATGAAAGATATTACAAGTTCACCAAAAACCTTCCTCCTGCTTTACAACCTAAATTCCCC
AGCTCTTCTGCAGCATACTCAGAATTCGATAGAACTTCTTTAAATGAAAACTTGGTAAGC
GAATACAACACATAAACTTTAGAATAATTCAAAAAGATTGTCAACAATTTTAGTCCAGAA
CAACCTGAAAATGTAATTCTTACTCCTATTGAAGGATTCTTTAAGAAGATCATGTTCTCT
GATAAGCTATATAACGAATTAATTGAATTAAATTTCTAATTGATGTACCAAAGCGAGGGT
GCTTCTAAGATTAGATTATTTGTTGAAATTCTTGACAAATTACGTGAACAGCACAAAGGA
AAAGACAAAATTGGCAAATTATTAAAAGATAATTTAATGAACAGTGCTCCTCTAGACAAT
CTGATTAAGACCAACCTTCATATAATTTTGAATAGCCTTTTCATAAAAAGAATAATAACT
AATAAAGAATATCAAGAAATTATGTTGCTTCTTGTTTCTAGAAATCAAAGCAATGATATG
ATAATATGTTTGGTATCTGCCTTGAGAGAGCTTATTTTTGAGAAAAAGGAATACACTCCT
TAAGATTTTAATGACTCAATTATTGCTCTTAAGTTAACAATGTCTAGTAAATAAGACATT
CCTCCTCATTACTCCTAGTTCTTGCAAGACCTCAACAAAATTGCATCTGAAAACTCTAAT
TAATCAAATAACATTATCACCTTTGAGCGTGCTCTTGATGTTATTACCAACTTCTATGGC
AATTTCGATAAAAAGCAGTATGAAGAAATATAGGAGAAGGTTGAAAAATGGCTTTCTTTG
TCAACTGAAGTTCAAATGGGCTAATTCATTTAAGGCCTTGTTAATATTATCATTGATAAT
CATGATGAAAACTCTTTAAAATTCTTTGTCTACTTTGCTGATATCTGCATCAACTACTCC
TTAGAAAGCGCTAAAAAGAATTAAAGAATTAGCATACAAAATATTACTAGTATGGACTTT
ACTTGCGTTGATAGTTTCACAAAATTGATTGAAATTATTCAAAAGACTTGCAAAATTGAA
CAATATAAGAAGCAATTACTTAATCAAATTTTCGATAGTATATTCATCACATTGACTAAA
TATCATGAAACTGATATGTATGAATTCAACCAGCGTCCATTCTTCCGTATCTTCTTTAAT
TTAATTTATGACAACCAAAGACCTAAATACGATTTCTCTAAGAATGAAATATCTGAAACT
TACAGCATGTTGGCTAACATATTCCATCAACTTTCCCCTGTAAAATACCCAGGATTTGCT
TTCTCTTGGTTAGAACTCATTTCAAATCGTTACTTCATGCCAGTGATTATGGAAAAGGAA
GAATTGTGGGGATTATACAGCCAACTCATAATAGATTTAATCAAATTCTTTAAAGAAATA
ATGCAAGAAGAAAACCTTCAATTAGAATACATTAAGATATTCTACAGAGGCACCATTCGT
ATTTTACTTGTCTTGCTTCATGACTGGCCTGATTTCTTAGCAAAATACTCTAATTCTTTA
TGTGATGAAATTCCTGAAAATTACATTTAAATTAGAAACATTATTCTCGCTGCTTTCCCT
AAAACTATGAAGCCACCTGATCCGTTCTCAAACAAAAACGAACAAATCTTTGAAAACAAT
GAAGACTTTAAGAATCCTCCTATTATGGACTACCCAGTTTATAATGAAAAAATCCAAGTC
GATCTCATGAATGATCTTCAGAATTATCTTCGCACTAAGAGCGAAGATATTTTCAAGACT
ATTTGCTCTAAATTGACTCTTAAAGAAAAATCATAATTTGTAATTGATTAGAAGGCTGTT
AACATACTCATTTTGGCTATACCTTTGCATTTACACAAGCAATCTGTAAATTAAGGAAAT
AAGGATACTAAAACAATCCCTCTAAACAACGATTTATACAATTTCTTACTTAAATTGCTT
AAAACAAGTCATTACGAAATGAGAGAAGTAATTCTTAACTTGATAATAAATCAAGTTAGA
TATCCTAACTTTATCACAAAGTTCTACATTAAATACATTCTGTTGACATTCTAAGAACAA
AATATTAATGATATTTAAGAACAAACCATTCGTATCATTGTAGAGAGATTGTTTGTATAG
AAACCTCACCCTTGGGGCATAATCTACACATTTATTGAGATCATTAAGTCTAATTCTAAT
TTCAGATCAAAGCCTTTTGTCAGAGATGCTGAATTGAAATAAGTTTTCCGCTTCATCTAC
TAAGAACCACCCAGATAAAGACCACCTCAATAATAGTAATAGCAACCATCATAACAACAG
ATTGGTCAGCACATACAACCTCAAGAGATGAACATAGATCAGTAAATGCACATGAATAGT
ATTTAGTACTAGCAGATATTGTAATAGCAACAATAGTAACAATACTAGCAACAATAGCAA
TATCAATAACAAATAGCAGGAGCTATAAGCCATCCTAACTATGTTAATAGAAATAATTGA


>TTHERM_00095500(gene)
ATGAAGAAAGAACTGGGTTAGAGCCAAGCTAACCAGTTCCTCAACAGAAGCGGAAATTCC
AATCAGCAATAGGGTTAAGGAAACGTTGCATCTCCCAACCTTCCTTAATTCATATAGATT
AAGAATTGGGTTGCTTAGCTCAATAACAAGAAGATTCTTAGAGCATAGAGGAACGACATT
ATGAATGTAATACATCTATCAATCTATCTATCTATTTTCATTTATTTTAGTAAGCATCGA
CTTCAAGTTGTAGCTAGCTCATATTGATTTCGCACTTGCTTTTATCATCCATCCATCATT
GCTATTCATAATTTCTTTCATGCTCCCTGTTCTTCTACTTAGGACTAAAGATTTTCAGTC
AGTCTATCTTCCCATTTATCCTTCCTTCTTTTTAGGTTTTTGGAAGTAGAAAATACACTG
ACTTTAAATATAACTCAAAAAATATATTTATATATCTTAGCTACTATTCTTATCTTTATA
GATATTATAAAGTCTTTTTCGGATCATTGTTTTCTCTTTAAAGATTAATCAATAAGTGAA
TTGATCATTCATTCATTCAATCCAATTTCTCCTTTCTTAAGCAATATTTATAACAAAGCA
ATAAAGCAAAAAAGCAAAAGTGCAAGCAACTACAGCTAATAGGAAAGAATGATTACTAAA
TGATAAAGCAATCGATGTTTTGATAGCAGTGGATAAAATATGTTAGCTACTCAAGCAGCG
GAAGCTCGATGCAATAAAATACATCATAATTAATTTTGTTTGTTTGTAAATTCATAGATA
GTACAATAACTAGGATCAGAAGGAAATTAGTATTTGTTGGAATGCCTTTTAGAAAGTTTG
GATATGAACTCACAGAATTCCCAAAATAAGGCAAATTTGCACACCACAGTTAAAGGCTAA
TTTTTGAGCCAACATTTGCATGATTTAATATTCAGCAATAGCTTCTCAAATTTTCTTGAT
TTCATGCCCAACGTCTTCATTAAAGTAGTTTGTGGACCTAATAGTTTTTCAAATTAAACC
AATACAAAGCAGCTAAATTAAGTGGTAAATTATGCTTAAGAACTGAGCAAGTGCCTCAAA
ATGAATCCTGTTGATTAGCTTTTCATAGCCTTAAGCTTTGCATGTTGCAACAACGAAACA
GTAGCATCAGAAGGTAATTTTTTTACATGCGTTTTCAAACTTGATAAATCCTAAATTTAT
TTTGAAGCCCATTTTCTAGTGATTAATTAGCATTAGATTAAGTATTTAAATAAAAAAAAA
GAGTGAAAAAAGTTAAGAATCTAATCAAAAAGCAAAAGAAAAAGCATGCAAACATCTGCC
GTTTTCAGCAAATAATAAAATGCTAATAAATCAAATGAATTTAAATATAAAATATATTTT
TTCAAGTCAAAATATAAAAATGTAAATAGAGAGCATCTAAATAAAAGGCAATTATTTATT
TATTTAGTGATCTCAAACTTTAAAAAAGATAGGAAAATATTAATTAATTGATTTATTAAG
CGCATTTTTTATTTAATTATTTTTTATGATTATTATCATAATTGGTTGATCTATTAAATC
ATTGAAAAAAATATTAAATGTTCTAAAGGATTAATTCCTTTAGCTATTCATTTATTTATT
AAAACCTGTTCATTTTATTTCAATACTACCATTTTTTAAATGACCATGTAAATAAAAATA
CAAGCAATAAAGTCAATCAATCAATAAATCAAAAAACAAAATATAACTAACTCATTTCAA
ATTTATTTTGCTTCTTCCTCATTATTTTCATTTATTTTAAAATTCTCTTCATTAATTATT
TAGACTAAATAAAATTCACTATAACCCAATTTATTATTAAAAATACATAAAGATTTTTAT
TTTCACTTGGATTTTTATTTTGTTAGTTTCATTCAAATAATTCATTTTATTTTAAATATT
AAAATTTAGGATATTTAAAATTAATTTCTATTTTACTTTTTATAAAAAAAAATGATTAAT
TAATTTTTTTTATTGTTTAAAGGTGTTAAGCTTCTCAGAGAAAAAATTATTGATTTTGTT
TAGTAGCAAAATTAAATTGCTTTGCCTCAAAATAACCTTCCAATTATTTTATTACAATTT
GTTTTGCAAAACCCTGAATTAAAGGTAATTAATAAGAACAATATCATTAATTTTGTTAAA
TTTTAGTTTTTCAAATTAAGAAATTCTAAAAAAATTAACATAGCTCAGTATATTAAATAA
AAATTAAAATCTTTGTATTTTAAAAATAGAATATGTCCCAAGAGATTCTTCAATTAAAGC
AAATACTCAATGATCCTAAAAATAAAGAAATCAAACCATTAATTTATGGTAGAGATAATA
TCGATGATGAAGGTAACAGCTAAGAAAGTGATGAAATATAAGACCCTGATTTACATAAAG
AAATAAACTATCCTAAGCCAGAAGAGTTAAACCACATAATAGGACCAGCTGACATTCTTA
AAGATTTAGGCCCAAGTGCACTATCTTCGATGGATAACTTAGTTAGAAGTTTATCATAAT
TTTAAAAATGGAGCAATTCTGATGTTTACCTCTCTCTCGAATTGATAGCATAAGACCCTG
TTTAATTAGGTGATGAATAAACTCAGCGTTTAGCTAACAATATTCTCCAAGTTGAATCCA
AAAACAGTAAAATTTTACACAAAAATTACAAATTTCAATAACTTTTTTTTCATTTTTTCA
AGGTTAACAAGAATGGGGTAATTTCACTAATTAAGATTAATCAGATAAAAACTAATAAAG
CGATTGGAATGCTGAGTTATTTATTGAATTCCTAATGAAGAAGATATTCCCTCAAAACAA
TGAATTAAATGTAATTACTTATTCAATACTTTAATAAAAAAAATTTAAAAGCAAGAATTT
TATCTTATTTATTAATAAGTAGTAGTATAAAAATTTAAAGTAATAGCAAATTCTAAAAAA
AATTGAAAAAAAGCATCTAAAATTTTGTATAACAAATATCAAAAAAGACCTCTAAAATAT
TTAAGCATAGAACATTTTTAAAAACTTAAGCAGCATCTTATACATATAAATTAATTCAAG
CATAAATAGCAAATAGTGTTAATAAGAAGTAAATAAATATAAAGAAAATGCTAAAATTAG
TAATTTTCAAATAGCTTAAATTCTATTTATTATGAAAACAATTAAAAAATAATAGTTTCA
AATCAAATCAATAATTTAAATATTAATTTCATTAAGAAACGATAAATACTTTACCTTAAA
TATATTTTTGATTAATAATTTTTTGGCATGTAAAAAATAGTCAAATATAATAATAAAATT
ATAATTAATTACTTTTTACTTTTTTTCAAATTTTTAATTATTTTTTTGTTTAAAATAGTG
GGTTTCCGTATTGACAGAAATTGATAGACCTTATTTGAAATTGAAGGACGAAAAATCTTT
TAAATAATTCTTTACTAATATGCTATTAATTCACAAAAAAGCTCCATTTTAAATGCCTGC
ATATTTGTTACTCAAGCCTTGGAAGAATATTAGAAGCCAAGCCTTATTCTTAAAGAATAT
GCTAGCTGTTGGTTCTTCTGAATTAGTAAGATGGAACGAAATTTAAAAAAATCCTATGAA
TTTAGAATTCAATCCATAATATAAATATAACACACTACCTTCTCCTATGCAGTTCTGGGC
CTGCTTGGATTTCCTCGATTTATTGTGTGAAATTAGTGAAGGAGATAACTATATGGCTAT
CCATGAGTTATTTGAGCTTCCTATTGCAAAATATCCAGATATCTTAATAGTCGCTTTATC
TTAACTGCATCCTAAAAAAGGTGCAAATCTCTTAGATGAAGTATTCAGTCAACTATTTCC
TAATTATTTGTCGAATCACATAAATTCTGTAGCTATTTTAGAAGCAATTTGGAAGAATAG
AGAGGATTTGCTTATTTCTGCTATTAGCGAACTTTATAGAAAAGAAAACAAGAAAGAAAA
CACATCTTTGAATTTATCAAGAGTCCTTGATATTTCCTAATATCTAAAAGACTCTTTAAT
TGCTCTCACAAATAGTAACAACTACTCTTTTTCTGTATCACTTGGTATTTTAGCTGGTAA
GAGAGAATTCCTACACTTTGACTAATGGCTAAATGAGCGTGTTAAGACTATTGGGGATCC
ATTTGTAAATGCTCTACTAGCATATATCGAAGACAATGTTATTAATCCAATTAAAGAAAT
AAATATGAGACTAAACAACCCCAACAATTAAGCTTAACAGTAATATGAAGGTGTTTTAGA
AAAGGCCTAACTAACTATTGAACTACTGACTATTATTTTTGAATCTCTTCTATTAGAGTA
ACACCCTGAAAAACTTACTAGCAAAAATCGTTAAAAGTTGTAAGATCAATATAAAGAAAT
ATTGTAATATTTCCCCTAATTAAGTGGAACTTCGGATTCACCAGGACAAGCTACAGAAAA
AAAAGCCAATTACAATTACCAAAGATTTTATATGAGAGAAATAACAATAGAGGAAATGAT
TGCAAATTTAAAATAATTAATGAATTCCAACAACTCTGAAGACAAAGAAGTGTTTGCATG
CATGATCACAAGCTTGATTGAAGAAGCTAAATACCACTAGTAATACCCCATAGCTGAGCT
TCTTTTAACAGGCTAACTCCAAGGAAGCATCATAAATGCACAGTAATTTAAAATTTATAA
ATTAGACTAATTTAATTATTCAATTAGCTTTAACTATTAATTATTTTTATCAATTTTATT
TATTTTATTTTTTTATAAATTTTTTTAATTAATTTGTTCACTTTTAATAGACTTGTCAAC
TAGAAACCATTAGGCATTATGCTAGAATAAATTTTGGAATCATCAAAAAAGACACAGAGA
TAAGTTGAGTAATCAGTAAAAGCAATAGAAGCTATGAAAGATCGCCTTCATGAATTCCCT
TACTTTGTAAATGCTCTTTTCGACCCATCCTGCCATCTTTCTGAGCAATTTCCTCAACTT
CTAATTAATATTTATAATGTAATTAAGTGTTTTACTTTTATTTATTTATTGACTTATTCT
TTTTTAATAAAGATTATGATTGAGAAGAAGGTATAAATTAATGTAACTAGTAAGCAAATT
GAATAGCTTAAATAAAGAGTAGAATCCCTTAAAAATGAAGCAAACAAACCATCTCAAACT
TACTAGGCAACAACAACTTAACAAGTAAACAATTTCAATCTAAAATTTTCCTTTTTACAA
TTGACTTTATTTTTTTAATAAAAAAGAAGAAGATCTTAAAGTTAAGAGGAGAAGTAGAAA
CTTCATCTGAAAATACCTCCTAACAACAATAAAATCAACAAGCATAGAACTAAGCTGCTG
CTGTAGCTCAATCTGATTAATCATCAGCACAGCCATAAGCATAAAATTAATAATAGTAAT
AACCATTATAGCAATAGGAAGGAAGTGCTTAGACAAAATAACAACAAGAATAAGATACTA
AAGCAAAAGCTGATTAGAATAACTAGCCTAGAAATCCTAGTGTTTAAAATGTAAGCTAAT
AAAATTTAGGTGAAGAAAAATAACCTTCTGATAACACCACACAAAGTAAAGGTAAAACTA
AAAAGCCTCTTTTTGCTGGATCTTCCGTATTTCCTTTGAGCAATTTAACTGCAAACTAAC
CAAAAATGGTATTCGAAAATCCTATTAATCAATAGATGAGATTCTAAGATACTTAAATAG
GAATGTATGACCAAGGATTGTATAATAATAATAATAATAGCACTAATAATAACAATAATG
GCAATAATACAGAAGAGATAGTTGTAAAAGCAAGACCTTACTAAGGAGGTGTTGGTTTTG
TTTAAAGACCTATATTTACAAACGGTGAACAATAAATCTATGCTTCTAAATCTATTAATG
AAATTTTAGAATATGAAAACTCACTTTAAATAGATGAATCAACAAAGATGAGAGTTAATT
TTGCACTAAATAATTTATCAGATGGAAACATAGAGAAACACTAAAATGATTTTAGAAATT
ACGCAGAAAATGAAAATTTTTAGAAATGGTTTGCTAGGCATCTTGTCACTCAAAGAGCTA
CTTTGAAATCAGAAATTAATGTCTTGCTGTACACTAAGCTCTGTGAAAGAATAGATAAGC
CTAAACTCTTTTCCTTTATCATAAAAGATTCTTTGTTACTTTTGCACAAACTTCTCTTAT
CAGAAGCTGCCATTCATGCTTCTATCCGTATTACCACTCTTAAAAATCTAGCTCATTGGA
TAGGCATGTTTACTTTGAATCGTAACAAACCAATCAATTCAAAATATTTGAATATCAAGG
CATTAATTGTCAATTCTTATCCGAACAAAGTTGATGTAATTATTCCTATTGTTATCAACA
TTCTACTTTGCTGTAAAGAATCAAAGATTTTTAATCCTTAAACTAACCGCTGGGTCAAGC
GTATTCTTTCTCTCTTAGAAGAATTCAAAAATGTGGTTCAGAAGGAAACTGTCAAGCATC
AAATTAATCAGTTGTTCTCTAATTTATAAATTGACGTAAATAGTTTAGAACCTTGTACCT
ACTTTAGATACTACTTACAAGAAAGTAAAAAGGAAGCTAAGCCAGCTTAATAGCCTGCTA
CTATTGTTTCTTTTTGCATCCGTGATAGACTAATAATTACAGATGATCTTCGCAACCTGT
GCAATATTTAAAACTTTGACTTAAAGTAAGCAGTTTTCCAATCCTTAGACGAAGCAATCA
TGGAAATTATACAACCAGTAATTTCTCGTAGTGTTACTATTGCCTTAGTCACCACTCGTG
AATTAGTCTTAAAAGATCACTGCACTGATCCTGATGAGAACAATCTTATAAATGGCATCT
CTAACATGGTTTAAAAACTATCTGGCTGTCTTGCTTTAATCACCTGCAAAGATCCACTCA
GATCAAGCTTCCAAACCCACTTAAAGACTAATTTAGAAAAAGTGACTGAATTAAATGCCA
ACGAAAAGGAATAAATCATTAATAAGGTAGTTATCGATAACATTGATATTGGCTGCCAAG
AAATCCGCTAAAGAGTAATGGATTAAGCTCTTAAGGAAATAAAATAAGATGATGCTATCC
TTGAAGCTATTGAAATGAGAAGAGCCGCAAAAGAAAAGTAGTAAGTATTTGTTGATGAAA
GATATTACAAGTTCACCAAAAACCTTCCTCCTGCTTTACAACCTAAATTCCCCAGCTCTT
CTGGTATATATTTTTGAATATAAATTTAATAAAAATAATAATTAAATTAAATAAATAAAT
AAGCAGCATACTCAGAATTCGATAGAACTTCTTTAAATGAAAACTTGGTAAGCGAATACA
ACACATAAACTTTAGAATAATTCAAAAAGAGTAACATTTTAAAATTAAAAAGTTTGTATT
AAATCCATATTTCGTTTAAATCTCTTTAGTTGTCAACAATTTTAGTCCAGAACAACCTGA
AAATGTAATTCTTACTCCTATTGAAGGATTCTTTAAGAAGATCATGTTCTCTGATAAGCT
ATATAACGAATTAATTGAATTAAATTTCTAATTGATGTACCAAAGCGAGGGTGCTTCTAA
GATTAGATTATTTGTTGAAATTCTTGACAAATTACGTGAACAGCACAAAGGAAAAGACAA
AATTGGCAAATTATTAAAAGATAATTTAATGAACAGTGCTCCTCTAGACAATCTGATTAA
GACCAACCTTCATATAATTTTGAATAGCCTTTTCATAAAAAGAATAATAACTAATAAAGA
ATATCAAGAAGTACTAAATTTATAAATAACATTTTTATTTACTTTTAATTATTTTCGATA
TAATTTCTTTGATATAATAAATAATTGATTATACTAAAATAAAGATTATGTTGCTTCTTG
TTTCTAGAAATCAAAGCAATGATATGATAATATGTTTGGTATCTGCCTTGAGAGAGCTTA
TTTTTGAGAAAAAGGAATACACTCCTTAAGATTTTAATGACTCAATTATTGCTCTTAAGT
TAACAATGTCTAGTAAATAAGACATTCCTCCTCATTACTCCTAGTTCTTGCAAGACCTCA
ACAAAATTGCATCTGAAAACTCTAATTAATCAAATAACATTATCACCTTTGAGCGTGCTC
TTGATGTTATTACCAACTTCTATGGCAATTTCGATAAAAAGCAGTATGAAGAAATATAGG
AGAAGGTTGAAAAATGGCTTTCTTTGTCAACTGAAGTTCAAATGGGCTAATTCATTTAAG
GCCTTGTTAATATTATCATTGATAATCATGATGAAAACTCTTTAAAATTCTTTGTCTACT
TTGCTGATATCTGCATCAACTACTCCTTAGAAAGCGCGTAAATAATCTTTTTTTATTGTT
TTAAATACAAGTCTTACTTATTTAATATATAAAACAGTAAAAAGAATTAAAGAATTAGCA
TACAAAATATTACTAGTATGGACTTTACTTGCGTTGATAGTTTCACAAAATTGATTGAAA
TTATTCAAAAGACTTGCAAAATTGAACAATATAAGAAGCAATTACTTAATCAAATTTTCG
ATAGTATATTCATCACATTGACTAAATATCATGAAACTGATATGTATGAATTCAACCAGC
GTCCATTCTTCCGTATCTTCTTTAATTTAATTTATGACAACCAAAGACCTAAATACGATT
TCTCTAAGAATGAAATATCTGAAACTTACAGCATGTTGGCTAACATATTCCATCAACTTT
CCCCTGTAAAATACCCAGGATTTGCTTTCTCTTGGTTAGAACTCATTTCAAATCGTTACT
TCATGCCAGTGATTATGGAAAAGGTAAAATTTAAAATAAAACATAAAATAAAATTTATTA
AAATTTATTTGTTTATCATTTATTATAGGAAGAATTGTGGGGATTATACAGCCAACTCAT
AATAGATTTAATCAAATTCTTTAAAGAAATAATGCAAGAAGAAAACCTTCAATTAGAATA
CATTAAGATATTCTACAGAGGCACCATTCGTATTTTACTTGTCTTGCTTCATGACTGGCC
TGATTTCTTAGCAAAATACTCTAATTCTTTATGTGATGAAATTCCTGAAAATTACATTTA
AATTAGAAACATTATTCTCGCTGCTTTCCCTAAAACTATGAAGCCACCTGATCCGTTCTC
AAACAAAAACGAACAAGTAAATATTTTTTTGTTTTTATTAGCTAAAAAATTAAATCTATT
AAATAGATCTTTGAAAACAATGAAGACTTTAAGAATCCTCCTATTATGGACTACCCAGTT
TATAATGAAAAAATCCAAGTCGATCTCATGAATGATCTTCAGAATTATCTTCGCACTAAG
AGCGAAGATATTTTCAAGACTATTTGCTCTAAATTGACTCTTAAAGAAAAATCATAATGT
AATTTTTTCAATAAAAAAGTGCTATGAAAACTAAATATACTTTAAATAAATATAGTTGTA
ATTGATTAGAAGGCTGTTAACATACTCATTTTGGCTATACCTTTGCATTTACACAAGCAA
TCTGTAAATTAAGGAAATAAGGATACTAAAACAATCCCTCTAAACAACGATTTATACAAT
TTCTTACTTGTAAATTATTATTGAAAATTAAAACAATAAATTTATTAAATTTTGATAAAA
AAATAGAAATTGCTTAAAACAAGTCATTACGAAATGAGAGAAGTAATTCTTAACTTGATA
ATAAATCAAGTTAGATATCCTAACTTTATCACAAAGTTCTACATTAAATACATTCTGTTG
ACATTCTAAGAACAAAATATTAATGATATTTAAGAACAAACCATTCGTATCATTGTAGAG
AGATTGTTTGTATAGAAACCTCACCCTTGGGGCATAATCTACACATTTATTGAGATCATT
AAGTCTAATTCTAATTTCAGATCAAAGCCTTTTGTCAGAGATGCTGAATTGAAATAAGTT
TTCCGCTTCATCTACTAAGAACCACCCAGATAAAGACCACCTCAATAATAGTAATAGCAA
CCATCATAACAACAGATTGGTCAGCACATACAACCTCAAGAGATGAACATAGATCAGTAA
ATGCACATGAATAGTATTTAGTACTAGCAGATATTGTAATAGCAACAATAGTAACAATAC
TAGCAACAATAGCAATATCAATAACAAATAGCAGGAGCTATAAGCCATCCTAACTATGTT
AATAGAAATAATTGA


>TTHERM_00095500(protein)
MKKELGQSQANQFLNRSGNSNQQQGQGNVASPNLPQFIQIKNWVAQLNNKKILRAQRNDI
MNIVQQLGSEGNQYLLECLLESLDMNSQNSQNKANLHTTVKGQFLSQHLHDLIFSNSFSN
FLDFMPNVFIKVVCGPNSFSNQTNTKQLNQVVNYAQELSKCLKMNPVDQLFIALSFACCN
NETVASEGVKLLREKIIDFVQQQNQIALPQNNLPIILLQFVLQNPELKNMSQEILQLKQI
LNDPKNKEIKPLIYGRDNIDDEGNSQESDEIQDPDLHKEINYPKPEELNHIIGPADILKD
LGPSALSSMDNLVRSLSQFQKWSNSDVYLSLELIAQDPVQLGDEQTQRLANNILQVESKN
SQQEWGNFTNQDQSDKNQQSDWNAELFIEFLMKKIFPQNNELNWVSVLTEIDRPYLKLKD
EKSFKQFFTNMLLIHKKAPFQMPAYLLLKPWKNIRSQALFLKNMLAVGSSELVRWNEIQK
NPMNLEFNPQYKYNTLPSPMQFWACLDFLDLLCEISEGDNYMAIHELFELPIAKYPDILI
VALSQLHPKKGANLLDEVFSQLFPNYLSNHINSVAILEAIWKNREDLLISAISELYRKEN
KKENTSLNLSRVLDISQYLKDSLIALTNSNNYSFSVSLGILAGKREFLHFDQWLNERVKT
IGDPFVNALLAYIEDNVINPIKEINMRLNNPNNQAQQQYEGVLEKAQLTIELLTIIFESL
LLEQHPEKLTSKNRQKLQDQYKEILQYFPQLSGTSDSPGQATEKKANYNYQRFYMREITI
EEMIANLKQLMNSNNSEDKEVFACMITSLIEEAKYHQQYPIAELLLTGQLQGSIINAQLV
NQKPLGIMLEQILESSKKTQRQVEQSVKAIEAMKDRLHEFPYFVNALFDPSCHLSEQFPQ
LLINIYNIMIEKKVQINVTSKQIEQLKQRVESLKNEANKPSQTYQATTTQQKKILKLRGE
VETSSENTSQQQQNQQAQNQAAAVAQSDQSSAQPQAQNQQQQQPLQQQEGSAQTKQQQEQ
DTKAKADQNNQPRNPSVQNVSQQNLGEEKQPSDNTTQSKGKTKKPLFAGSSVFPLSNLTA
NQPKMVFENPINQQMRFQDTQIGMYDQGLYNNNNNSTNNNNNGNNTEEIVVKARPYQGGV
GFVQRPIFTNGEQQIYASKSINEILEYENSLQIDESTKMRVNFALNNLSDGNIEKHQNDF
RNYAENENFQKWFARHLVTQRATLKSEINVLLYTKLCERIDKPKLFSFIIKDSLLLLHKL
LLSEAAIHASIRITTLKNLAHWIGMFTLNRNKPINSKYLNIKALIVNSYPNKVDVIIPIV
INILLCCKESKIFNPQTNRWVKRILSLLEEFKNVVQKETVKHQINQLFSNLQIDVNSLEP
CTYFRYYLQESKKEAKPAQQPATIVSFCIRDRLIITDDLRNLCNIQNFDLKQAVFQSLDE
AIMEIIQPVISRSVTIALVTTRELVLKDHCTDPDENNLINGISNMVQKLSGCLALITCKD
PLRSSFQTHLKTNLEKVTELNANEKEQIINKVVIDNIDIGCQEIRQRVMDQALKEIKQDD
AILEAIEMRRAAKEKQQVFVDERYYKFTKNLPPALQPKFPSSSAAYSEFDRTSLNENLVS
EYNTQTLEQFKKIVNNFSPEQPENVILTPIEGFFKKIMFSDKLYNELIELNFQLMYQSEG
ASKIRLFVEILDKLREQHKGKDKIGKLLKDNLMNSAPLDNLIKTNLHIILNSLFIKRIIT
NKEYQEIMLLLVSRNQSNDMIICLVSALRELIFEKKEYTPQDFNDSIIALKLTMSSKQDI
PPHYSQFLQDLNKIASENSNQSNNIITFERALDVITNFYGNFDKKQYEEIQEKVEKWLSL
STEVQMGQFIQGLVNIIIDNHDENSLKFFVYFADICINYSLESAKKNQRISIQNITSMDF
TCVDSFTKLIEIIQKTCKIEQYKKQLLNQIFDSIFITLTKYHETDMYEFNQRPFFRIFFN
LIYDNQRPKYDFSKNEISETYSMLANIFHQLSPVKYPGFAFSWLELISNRYFMPVIMEKE
ELWGLYSQLIIDLIKFFKEIMQEENLQLEYIKIFYRGTIRILLVLLHDWPDFLAKYSNSL
CDEIPENYIQIRNIILAAFPKTMKPPDPFSNKNEQIFENNEDFKNPPIMDYPVYNEKIQV
DLMNDLQNYLRTKSEDIFKTICSKLTLKEKSQFVIDQKAVNILILAIPLHLHKQSVNQGN
KDTKTIPLNNDLYNFLLKLLKTSHYEMREVILNLIINQVRYPNFITKFYIKYILLTFQEQ
NINDIQEQTIRIIVERLFVQKPHPWGIIYTFIEIIKSNSNFRSKPFVRDAELKQVFRFIY
QEPPRQRPPQQQQQQPSQQQIGQHIQPQEMNIDQQMHMNSIQYQQILQQQQQQQYQQQQQ
YQQQIAGAISHPNYVNRNN