Identifiers and Description

Gene Model Identifier

TTHERM_00102830

Standard Name

CMT2 (mRNA Cap guanine-N7 MethylTransferase 2)

Aliases

PreTt22983 | 7.m00432

Description

CMT2 mRNA capping enzyme large subunit family protein; Methyltransferase; catalyzes transfer of methyl group from S-adenosylmethionine to GpppN terminus of capped mRNA

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03291 ) mRNA capping enzyme, large subunit
  • ( PF08241 ) methyltransferase domain
  • ( TIGR02863 ) small, acid-soluble spore protein, SspJ

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00335.1 9.997093137033517e-262
Description: hypothetical protein (667 aa)
Oxytricha Contig18517.0.g33 4.001630327199692e-20
Description: mRNA capping enzyme
SGD YBR236C 0.00000019998969434520019
Description: ABD1 Methyltransferase, catalyzes the transfer of a methyl group from S-adenosylmethionine to the GpppN terminus of capped mRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00102830(coding)
ATGAATCATAGAAATTCTAATTACAAGCTAAACAGATACAATAACAATAACAACAATAGT
AATTCTTATCCAGCCTTCCGTTAGGACAATTAAAACCGTGGTGGCGGAGATAGAGGAAAT
TACAACTAAGGAGGATCAAACAATAATAACAGTTCTAATAGCAATAACAATCCTAATAAC
TACTACAATCATTAGAATCCAAGTGGTGGCAATAGCTATCAAAGCGGAAGTGGAAACCAT
GGCAATTATGGAGGTGAAACTTACTAAAATTCTGATAGACGTGGCGGAGATAACAGAAGA
GGAGGTGGATATGGCAATAAAGACAGATATGCTTCTTCAGGTGATAACTACCACGGTAGT
CATGGAGGTAGTGGCACTAATAACCACCATGGAAACGGCGGCTATTAAAACAATAATAAC
AGCAGTTACAATTAAGGTGGATACAGTGGAAATAATCACAGTAGCGGAGGCAGCAGAGGT
GGATATCATCATAACGATAATAGAAGATAACACAACAACAACAACAATAATAATAGCAAC
AATAACAGCAACTTAAATAACTAGCGTGGAAGCGGTGGAAGTGGTAAAATGAGAGGAGAT
AGAAACTACGATAGAAGAAGATAAGACAGAAACAATAACAGATCTTCAAATCACTACTCT
GGCGGTAATCAAGGAGGTTCTCATCATGGAGGAAATCACAGAAATAACGCAGGAGGTCAC
CACGGCGGACATGGTCATCACAACAATAGTGGACATAACAACCATCATCACCAATCTTCT
TCTAATAATTAAGTTCAGAACTTCTACAATAATAATAAGGGATTCAATTAGTAGGAAAGA
AAGAATTTAGAAACCTTCCATATCAGAGTCTTCCATAATTGGGTAAAGAGTGTTCTTATT
CAGAAATATGGTGAGATATAGAGATCTATTGTCAAAGCAGAGAATGCCAAATTACCTGAA
AATTATTTATACATTTTGGACTTGGCTTGTGGTAAGGGTGGTGACCACAAAAAGTGGTTA
ATGCATAGTCATGCTTGCTTTTACATTGGTGTTGATATTGCCATGGAAGCATTAAACTAA
GCATACTAGAGAGCAATAATCACTTTAAACGAAATTAAATAAAACAGTCGCTATCATTCC
AACATTAAATTCGGGTTCTTCTAAAAAGATTGTTCTTGTTCAAGCGAAGATTTTTGGAAG
CACATTAACGCTCCTCCAAATAATGCACTCACTGCTGCTGAGAACGAAGCTTAAGGATCT
GAATTGAAAGAAGATGGTAATGAGAAGAACGAAAATAAGCCAAATAATGAAGATTAAATG
GATCTTGAAGGAGGAAATAAAAAAGAAAATGAAGAAACTAATTAAGATGAAGGCTAATCA
CCTAAAAAGGAAGAAAATAATGAAAAAGAATAAAATAAAGATAAAGAATAGTATGGTAAA
TATATGTTCGATGTTGTTTCCTGTTAAATGGCTATGCATTACATGCATGAAAGTGAAGAA
AAAGTAAGAAATTTCTTAGATAATTGCACAAAAAGATTAAACGATTAAGGCTTCTTGCTT
TTAACTTTCACAGACGGTAATGCTGTCTTAGATATTATGAAGAGCAAAGGTCAACCTACT
CCTGAAGGTGGTACTATTTATTCAAGCAAACACTTCAGTATGAAATTTGATAATCCTGTT
GAATAAATTGATCTCCAATAAAATCCTTATGGTAACAAATACGGATTCTACTTACAAGAG
TCAGTTGGTTCTTAAGTCGAAGGAGTTATCAAATACGTTCCTGAATATCTAGTAAATGTT
GACTTGTTCATTGAAACTGCAAAAGAATACTCCTTAGAAGTAAAGGAAAATAACCTTCTA
ACTGACTTCTACGAAAATAACAAGACTCCATTTGCTGACCTCTTAAAGTAAATGAAGGTA
ACTTACTCTCAAGAAGAAGAATAGAAAGATCCTTTCTCCTGGGAAGTTTCTCACTGCTAC
CGTGCCGTAGTATTTTAGAAGGTCTTAGCTCAACCCAACAGATATTAGTTTGATAGATCC
ACTCGTGACAAATACTTACTCAAATATCCTGTCCAACTTAATTACTCTCCTAAGAAGAAA
GAAGATTGA


>TTHERM_00102830(gene)
ATGAATCATAGAAATTCTAATTACAAGCTAAACAGATACAATAACAATAACAACAATAGT
AATTCTTATCCAGCCTTCCGTTAGGACAATTAAAACCGTGGTGGCGGAGATAGAGGAAAT
TACAACTAAGGAGGATCAAACAATAATAACAGTTCTAATAGCAATAACAATCCTAATAAC
TACTACAATCATTAGAATCCAAGTGGTGGCAATAGCTATCAAAGCGGAAGTGGAAACCAT
GGCAATTATGGAGGTGAAACTTACTAAAATTCTGATAGACGTGGCGGAGATAACAGAAGA
GGAGGTGGATATGGCAATAAAGACAGATATGCTTCTTCAGGTGATAACTACCACGGTAGT
CATGGAGGTAGTGGCACTAATAACCACCATGGAAACGGCGGCTATTAAAACAATAATAAC
AGCAGTTACAATTAAGGTGGATACAGTGGAAATAATCACAGTAGCGGAGGCAGCAGAGGT
GGATATCATCATAACGATAATAGAAGATAACACAACAACAACAACAATAATAATAGCAAC
AATAACAGCAACTTAAATAACTAGCGTGGAAGCGGTGGAAGTGGTAAAATGAGAGGAGAT
AGAAACTACGATAGAAGAAGATAAGACAGAAACAATAACAGATCTTCAAATCACTACTCT
GGCGGTAATCAAGGAGGTTCTCATCATGGAGGAAATCACAGAAATAACGCAGGAGGTCAC
CACGGCGGACATGGTCATCACAACAATAGTGGACATAACAACCATCATCACCAATCTTCT
TCTAATAATTAAGTTCAGAACTTCTACAATAATAATAAGGGATTCAATTAGTAGGAAAGA
AAGAATTTAGAAACCTTCCATATCAGAGTCTTCCATAATTGGGTAAAGAGTGTTCTTATT
CAGAAATATGGTGAGATATAGAGATCTATTGTCAAAGCAGAGAATGCCAAATTACCTGAA
AATTATTTATACATTTTGGACTTGGCTTGTGGTAAGGGTGGTGACCACAAAAAGTGGTTA
ATGCATAGTCATGCTTGCTTTTACATTGGTGTTGATATTGCCATGGAAGCATTAAACTAA
GCATACTAGAGAGCAATAATCACTTTAAACGAAATTAAATAAAACAGTCGCTATCATTCC
AACATTAAATTCGGGTTCTTCTAAAAAGATTGTTCTTGTTCAAGCGAAGATTTTTGGAAG
CACATTAACGCTCCTCCAAATAATGCACTCACTGCTGCTGAGAACGAAGCTTAAGGATCT
GAATTGAAAGAAGATGGTAATGAGAAGAACGAAAATAAGCCAAATAATGAAGATTAAATG
GATCTTGAAGGAGGAAATAAAAAAGAAAATGAAGAAACTAATTAAGATGAAGGCTAATCA
CCTAAAAAGGAAGAAAATAATGAAAAAGAATAAAATAAAGATAAAGAATAGTATGGTAAA
TATATGTTCGATGTTGTTTCCTGTTAAATGGCTATGCATTACATGCATGAAAGTGAAGAA
AAAGTAAGAAATTTCTTAGATAATTGCACAAAAAGATTAAACGATTAAGGCTTCTTGCTT
TTAACTTTCACAGACGGTAATGCTGTCTTAGATATTATGAAGAGCAAAGGTCAACCTACT
CCTGAAGGTGGTACTATTTATTCAAGCAAACACTTCAGTATGAAATTTGATAATCCTGTT
GAATAAATTGATCTCCAATAAAATCCTTATGGTAACAAATACGGATTCTACTTACAAGAG
TCAGTTGGTTCTTAAGTCGAAGGAGTTATCAAATACGTTCCTGAATATCTAGTAAATGTT
GACTTGTTCATTGAAACTGCAAAAGAATACTCCTTAGAAGTAAAGGAAAATAACCTTCTA
ACTGACTTCTACGAAAATAACAAGACTCCATTTGCTGACCTCTTAAAGTAAATGAAGGTA
ACTTACTCTCAAGAAGAAGAATAGAAAGATCCTTTCTCCTGGGAAGTTTCTCACTGCTAC
CGTGCCGTAGTATTTTAGAAGGTCTTAGCTCAACCCAACAGATATTAGTTTGATAGATCC
ACTCGTGACAAATACTTACTCAAATATCCTGTCCAACTTAATTACTCTCCTAAGAAGAAA
GAAGATTGA


>TTHERM_00102830(protein)
MNHRNSNYKLNRYNNNNNNSNSYPAFRQDNQNRGGGDRGNYNQGGSNNNNSSNSNNNPNN
YYNHQNPSGGNSYQSGSGNHGNYGGETYQNSDRRGGDNRRGGGYGNKDRYASSGDNYHGS
HGGSGTNNHHGNGGYQNNNNSSYNQGGYSGNNHSSGGSRGGYHHNDNRRQHNNNNNNNSN
NNSNLNNQRGSGGSGKMRGDRNYDRRRQDRNNNRSSNHYSGGNQGGSHHGGNHRNNAGGH
HGGHGHHNNSGHNNHHHQSSSNNQVQNFYNNNKGFNQQERKNLETFHIRVFHNWVKSVLI
QKYGEIQRSIVKAENAKLPENYLYILDLACGKGGDHKKWLMHSHACFYIGVDIAMEALNQ
AYQRAIITLNEIKQNSRYHSNIKFGFFQKDCSCSSEDFWKHINAPPNNALTAAENEAQGS
ELKEDGNEKNENKPNNEDQMDLEGGNKKENEETNQDEGQSPKKEENNEKEQNKDKEQYGK
YMFDVVSCQMAMHYMHESEEKVRNFLDNCTKRLNDQGFLLLTFTDGNAVLDIMKSKGQPT
PEGGTIYSSKHFSMKFDNPVEQIDLQQNPYGNKYGFYLQESVGSQVEGVIKYVPEYLVNV
DLFIETAKEYSLEVKENNLLTDFYENNKTPFADLLKQMKVTYSQEEEQKDPFSWEVSHCY
RAVVFQKVLAQPNRYQFDRSTRDKYLLKYPVQLNYSPKKKED