Identifiers and Description

Gene Model Identifier

TTHERM_00106890

Standard Name

RFA1 (Homolog of budding yeast RFA1 and mouse RPA1)

Aliases

PreTt23083 | 7.m00532

Description

RFA1 replication protein complex A largest subunit; Encodes Replication Protein A (RPA). Protein involved in recombination and DNA repair

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF04057 ) Replication factor-A protein 1, N-terminal
  • ( PF07656 ) KWG Leptospira
  • ( PF07975 ) TFIIH C1-like domain
  • ( PF08646 ) Replication factor-A C terminal domain
  • ( TIGR00617 ) replication factor-a protein 1 (rpa1)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00409.1 9.997093137033517e-262
Description: hypothetical protein (659 aa)
Oxytricha Contig5713.0.g13 4.000054831110256e-33
Description: Replication factor-A C terminal domain
SGD YAR007C 6.001249495680822e-29
Description: RFA1 Subunit of heterotrimeric Replication Protein A (RPA), which is a highly conserved single-stranded DNA binding protein involved in DNA replication, repair, and recombination
WormBase WBGene00017546 1.9993007828132465e-27
Description: locus:rpa-1 Probable replication factor A 73 kDa subunit status:Confirmed UniProt:Q19537 protein_id:CCD62042.1
DictyBase DDB_G0289513 0.0000000000599805963605737
Description: rfa1 on chromosome: 5 position 2891660 to 2893699
Stentor Coeruleus SteCoe_15423 0.0000000001026187963170189
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:20363756: Min B, Collins K (2010) Multiple mechanisms for elongation processivity within the reconstituted tetrahymena telomerase holoenzyme. The Journal of biological chemistry 285(22):16434-43

Sequences

>TTHERM_00106890(coding)
ATGGTTACTCAATTAACAAAAAATGCTATTGATTCTCTAATAAATAGCACTAATCCTGAT
GAATAGTATGTTATTCAAGTTTTAAAAGCTCCTCAATCTGTTGCTGAAAATCTTTTCAAG
ATTTGCATTTCTGATGGCTTTTGCAAATTCAAGAAAGGATATTTCGTTAGTGATGCTGCT
ACCAAATGCCAAGATTTGAAGGATCTCTGTATTATCAAATGCAAAAAATATATTGATGAC
TCAAACCACGATAAGGAAAGAATTATTATCTCTAACTACGAATTAATATATTCTAATATC
TAAGAGCAAATTGGAAAACCAATCGAATACAAATAATACAAGTCAAGTGGATTCTCTAAT
CCAGAAGGATCAACTGTAATTCCCTCATAATACTTGAGCAGAAACGCTTAAATACTTCAA
TAAAATTAAGTTTCTTAACCTAAGCAAATGGTAACTCCTCCAGTTAGCAACATAAATAAG
CCTACTCCTGCTGTAAATAACACATTTGCTTAAAAACCAGCAGTTACAAACTAAAACATT
TAAAGAGTAAACTAGAATCCATAACAAATGAACAAAACTGCACCTGTAAAGCAAAATAAT
AATAATAACAATAATAACAATGGCAACAACAAAAATAATTCTAGTTTGTAGATTTCTACT
GATGGAGATGAGTAAAATTTGGAATACATTAGAAACTTATAGCCAAATGGTTAACCATAA
ACAATCAAAGTTAGAATCACCAAAAAGGGTGATTTGAAAAGCTTTAAGGAAAAGTAAGGA
AAACTCTTTTCAATAGATGTTATTGATAAGTTTGGAGACGAATGTAGTATTTCTTTCTTC
AACGAAATAGCTGAATAGTATGATGGCTTATTTAAAGTAGGTTAAGTTATAGTCTTGAAA
TAATTTTCAGTGAAAGTCAACAATAATCATCAATACAATAAGGGAGATCACACTGTAACT
GTCAATAAAGAGAGTAAAATATTGATATGTCAAGAAGATCCATCTATTCCTATGATCAAA
TTAAATAGATAATTCATTTAAGATATGTAGAATAAATAGAAAGGAGATTTAATCGATTTG
ATTGTTGTTGTAAAGGCAGACACAGAAGTTAAAACCATGATCTTAAAGAAAGATAATTAA
TAATAATCTAAAAGAGACATAATATCATTTGATGAATCTCTAATTGAAACAGAAATCACA
CTCTGGGGAGAAACTGCTAAAGACTATGATGCAAAGTAGGGAGATATCATTGTATTTAAA
GATGCCAAAATAGGTGAATTTAAAGATAAAAAGTAAATTAATATCGGATATGGAACATAA
ATCTTCATGAATCCAGATGAATAACTCTTCCCATAGATCCATGATGTCAAAAAATGGTAC
CTAAGCTTAAATTCCGACTAATTAAGCACTATTCAAAAGGCATAAGGAAATGATACTGGT
CCTAGAGAAGTAACTAGCTTTGAATCTTCTCTAAACATTTTGAAAGAAGAAATTAAAAAC
CTTTAAACTGACCCAGAAATGAAAATTTGGAAAGAAATTCGTGGTTAAATTATGTACATT
AAAGATACTCCTCTTTATTATAATGCTTGTTTTAGTTGCAAAAAGAAAATCGCACGTAAT
AACGAAGTATGGACTTGCATAAATTGCAATAAAGATTTTAATGAACCTGACTCTAGATAT
ATTCTCTCCCTCAATATAAGTGACTCTACAGATACTATTTGGGTAAGTGCATTCGATGAA
GTAGGTCAAAAAATTCTTGGTAAATTTATTTTTTAAAAGTTAAACTAAGTTAATTTATTT
TTATCATATTTAATTAACTTATTAATTAAACAGGTGTTAAGGGTGATGTATTTAGATATG
CTGATGAAGATACAGAACACGGTACAGAAACAAAAAAGAAATTGCTTATGGCTGCCTAAA
ATAAGGAATATAGATTCCTGTTACTTACTAAATAAGAAAGAGACTAAAATGGCAACGCCA
GAGATAAGACAGTTATTCATGCTATAAAAGACTTTTAACCTGCTTATGAGGCCAAAAAGA
TCATCAATTCTTTGGAGAAATTTATGGTGA


>TTHERM_00106890(gene)
ATGGTTACTCAATTAACAAAAAATGCTATTGATTCTCTAATAAATAGCACTAATCCTGAT
GAATAGTATGTTATTCAAGTTTTAAAAGCTCCTCAATCTGTTGCTGAAAATCTTTTCAAG
TAATTTAATTGATTGATCGATTGAAAAAAACTAATTTTATTCATTTCTTTTTTTTGTTGA
CAAATAGGATTTGCATTTCTGATGGCTTTTGCAAATTCAAGAAAGGATATTTCGTTAGTG
ATGCTGCTACCAAATGCCAAGATTGTAATTAATTTTTCTTAATTTTTTGTGAAGAATTGT
ATATGGAAAAGTACTATCATTTTTAACTCTACTTTAATAATTTAATAGTGAAGGATCTCT
GTATTATCAAATGCAAAAAATATATTGATGACTCAAACCACGATAAGGAAAGAATTATTA
TCTCTAACTACGAATTAATATATTCTAATATCTAAGAGCAAATTGGAAAACCAATCGAAT
ACAAATAATACAAGTCAAGTGTAATAAAATATTTCTAAAGTTCTATATAATTTATTTTAT
TCTTTGCTACTTGATCAAAAATGCTCTTTAAAGGGAGTTTTCAAGATATGGCAAAAAAAT
AAAAATATGTTCTTGAAAATTAATAATTTTTAAATTAAATATAAAAGGGATTCTCTAATC
CAGAAGGATCAACTGTAATTCCCTCATAATACTTGAGCAGAAACGCTTAAATACTTCAAT
AAAATTAAGTTTCTTAACCTAAGCAAATGGTAACTCCTCCAGTTAGCAACATAAATAAGC
CTACTCCTGCTGTAAATAACACATTTGCTTAAAAACCAGCAGTTACAAACTAAAACATTT
AAAGAGTAAACTAGAATCCATAACAAATGAACAAAACTGCACCTGTAAAGCAAAATAATA
ATAATAACAATAATAACAATGGCAACAACAAAAATAATTCTAGTTTGTAGATTTCTACTG
ATGGAGATGAGTAAAATTTGGAATACATTAGAAACTTATAGCCAAATGGTTAACCATAAA
CAATCAAAGTTAGAATCACCAAAAAGGGTGATTTGAAAAGCTTTAAGGAAAAGTAAGGAA
AACTCTTTTCAATAGATGTTATTGATAAGTTTGGAGACGAATGTAGTATTTCTTTCTTCA
ACGAAATAGCTGAATAGTATGATGGCTTATTTAAAGTAGGTTAAGTTATAGTCTTGAAAT
AATTTTCAGTGAAAGTCAACAATAATCATCAATAGTAAATTAATTTATTTAAGTTTTAGC
AATTACTATTACATAATATTTAATAAATAGCAATAAGGGAGATCACACTGTAACTGTCAA
TAAAGAGAGTAAAATATTGATATGTCAAGAAGATCCATCTATTCCTATGATCAAATTAAA
TAGATAATTCATTTAAGATATGTAGAATAAATAGAAAGGAGATTTAATCGATTTGATTGT
TGTTGTAAAGGCAGACACAGAAGTTAAAACCATGATCTTAAAGAAAGATAATTAATAATA
ATCTAAAAGAGACATAATATCATTTGATGAATCTCTAATTGAAACAGAAATCACACTCTG
GGGAGAAACTGCTAAAGACTATGATGCAAAGTAGGGAGATATCATTGTATTTAAAGATGC
CAAAATAGGTGAATTTAAAGATAAAAAGTAAATTAATATCGGATATGGAACATAAATCTT
CATGAATCCAGATGAATAACTCTTCCCATAGATCCATGATGTCAAAAAATGGTACCTAAG
CTTAAATTCCGACTAATTAAGCACTATTCAAAAGGCATAAGGAAATGATACTGGTCCTAG
AGAAGTAACTAGCTTTGAATCTTCTCTAAACATTTTGAAAGAAGAAATTAAAAACCTTTA
AACTGACCCAGAAATGAAAATTTGGAAAGAAATTCGTGGTTAAATTATGTACATTAAAGA
TACTCCTCTTTATTATAATGCTTGTTTTAGTTGCAAAAAGAAAATCGCACGTAATAACGA
AGTATGGACTTGCATAAATTGCAATAAAGATTTTAATGAAGTAATATTTTTTCTTATTCA
TCTTTAAAATTTTAGTTAATAAAATTAATTTTATTAAAATATAATTGAATTTATTTTAAA
TAATAATTTTATTAGCCTGACTCTAGATATATTCTCTCCCTCAATATAAGTGACTCTACA
GATACTATTTGGGTAAGTGCATTCGATGAAGTAGGTCAAAAAATTCTTGGTAAATTTATT
TTTTAAAAGTTAAACTAAGTTAATTTATTTTTATCATATTTAATTAACTTATTAATTAAA
CAGGTGTTAAGGGTGATGTATTTAGATATGCTGATGAAGATACAGAACACGGTACAGAAA
CAAAAAAGAAATTGCTTATGGCTGCCTAAAATAAGGAATATAGATTCCTGTTACTTACTA
AATAAGAAAGAGACTAAAATGGCAACGCCAGAGATAAGACAGTTATTCATGCTATAAAAG
ACTTTTAACCTGCTTATGAGGCCAAAAAGATCATCAATTCTTTGGAGAAATTTATGGTGA


>TTHERM_00106890(protein)
MVTQLTKNAIDSLINSTNPDEQYVIQVLKAPQSVAENLFKICISDGFCKFKKGYFVSDAA
TKCQDLKDLCIIKCKKYIDDSNHDKERIIISNYELIYSNIQEQIGKPIEYKQYKSSGFSN
PEGSTVIPSQYLSRNAQILQQNQVSQPKQMVTPPVSNINKPTPAVNNTFAQKPAVTNQNI
QRVNQNPQQMNKTAPVKQNNNNNNNNNGNNKNNSSLQISTDGDEQNLEYIRNLQPNGQPQ
TIKVRITKKGDLKSFKEKQGKLFSIDVIDKFGDECSISFFNEIAEQYDGLFKVGQVIVLK
QFSVKVNNNHQYNKGDHTVTVNKESKILICQEDPSIPMIKLNRQFIQDMQNKQKGDLIDL
IVVVKADTEVKTMILKKDNQQQSKRDIISFDESLIETEITLWGETAKDYDAKQGDIIVFK
DAKIGEFKDKKQINIGYGTQIFMNPDEQLFPQIHDVKKWYLSLNSDQLSTIQKAQGNDTG
PREVTSFESSLNILKEEIKNLQTDPEMKIWKEIRGQIMYIKDTPLYYNACFSCKKKIARN
NEVWTCINCNKDFNEPDSRYILSLNISDSTDTIWVSAFDEVGQKILGKFIFQKLNQVNLF
LSYLINLLIKQVLRVMYLDMLMKIQNTVQKQKRNCLWLPKIRNIDSCYLLNKKETKMATP
EIRQLFMLQKTFNLLMRPKRSSILWRNLW