Identifiers and Description

Gene Model Identifier

TTHERM_00106960

Standard Name

SCL1 (20S proteasome core alpha subunit 1)

Aliases

PreTt23090 | 7.m00566

Description

SCL1 proteasome subunit alpha type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • 17-beta-hydroxysteroid dehydrogenase (NADP+) activity (IEA) | GO:0072582

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00421.1 8.997766383757294e-176
Description: proteasome A-type and B-type family protein (246 aa)
DictyBase DDB_G0278847 1.0002758036576784e-62
Description: psmA6 on chromosome: 3 position 1274786 to 1275953
SGD YGL011C 5.9995872346509964e-61
Description: SCL1 Alpha 1 subunit of the 20S proteasome involved in the degradation of ubiquitinated substrates; 20S proteasome is the core complex of the 26S proteasome; essential for growth; detected in the mitochondria
Oxytricha Contig17068.0.g82 2.0007467515522948e-59
Description: Proteasome subunit
WormBase WBGene00003922 2.9987037581344066e-55
Description: locus:pas-1 Proteasome subunit alpha type-6 status:Confirmed UniProt:O17586 protein_id:CAB02738.1
Stentor Coeruleus SteCoe_7441 6.054601895401186e-39
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00106960(coding)
ATGAGCGGATCAGAAACCCAAATTACAGTTTTTTCACCTGAAGGAAGACTCTTCTAAGTA
GAATATGCTTAAAGAGCTGTTAAAAACTCTGGTATCACTACTATTGGTGTCAGAGGTAAG
GATTGTGTTGTTTTAATTACCGAAAAGAAGACCTAAGAAAGTTATGTAGATATGAATTCC
TTCACTAATATTCACACCGTAAGCGAACGTGTTGGTGCTGCTACCACCGGTTATTACCCT
GACTCTAAAGCCATTGTAACCAGACTTAGATAGGAAGCCAGTGAATATAAGCTTAAAAAT
GGTCACTTCATGCCTGTTGATTAGCTCTCTTGCAGATTAGGTGATTTATCCTAAGTTTAT
ACTCAAAAGGCTTTCATGAGACCTTACGCTGTTGAAACTATTCTTGCTGGATATGACAAC
GAATTAGGTCCTTTACTTTATAAGAACGATCCTTCTGGTTACTTCTGTGGTTACAGAGCT
GTTGCATCAGGTATTAAGGAACAAGATGCTATCCATTAATTAGAAAAGGAATTTAAAAAA
GATAAGAACGCCACTTCCATGAGCTTTGATAAAACTATAGAAGTTGCCATCAATACTTTA
AAAAATATTCTTAACCGTGAATTCAATCCTACTGATATTGAAATTGGTGTTGTAAGTAAA
GAATAACCTAAATTCAAAAAGCTTAACGAATAAGAAATCGAAGAAGCTCTCAGAAGAACT
AACCAATCAAAGTAATGA


>TTHERM_00106960(gene)
ATGAGCGGATCAGAAACCCAAATTACAGTTTTTTCACCTGAAGGAAGACTCTTCTAAGTA
GGTAAATGAAGTTATAATCGATTTAAATATAGCAAGCTATATGTTCAATTAAAATTTTGC
TCAAGAAGTCTTCACTATTCTAAAGTCTTACTGAAAGTTGCAATTAATAGAAATTAAAAA
CGATATATTTTGAGATCGAAAGAACAAAGAACAATTTTAAATGAAACAATTATTGATTGA
ATGTTGCAAAAATTAACTTTATTTATTTATAATTTAACAGAATATGCTTAAAGAGCTGTT
AAAAACTCTGGTATCACTACTATTGGTGTCAGAGGTAAGGATTGTGTTGTTTTAATTACC
GAAAAGAAGACCTAAGTACTTAATTTATTCATTCATTGATTTAAAAGCGATCCAAAAGCC
TTTTTAGATAAAATGAAATTTTACAAAATGATTTTTGTTAAATTTTGTTTAGAATTAGAA
GTTAATAAGCTTTATTTGGTTAAAATTTTATTGTAATATTATCAGGAAAGTTATGTAGAT
ATGAATTCCTTCACTAATATTCACACCGTAAGCGAACGTGTTGGTGCTGCTACCACCGGT
TATTACCGTAATTCTTATTTAAAATATATATATGCGTATTCAATTACTAAACCATTTAAA
TAAATTTAATTTTTAATGAAATTAGCTGACTCTAAAGCCATTGTAACCAGACTTAGATAG
GAAGCCAGTGAATATAAGCTTAAAAATGGTAAAAATATGACAACGTAATTTAAAAAATCT
AAAGTATTTTTGAATTAATTTAGGTCACTTCATGCCTGTTGATTAGCTCTCTTGCAGATT
AGGTGATTTATCCTAAGTTTATACTCAAAAGGCTTTCATGAGACCTTACGCTGTTGGTAT
ATATTAATAATTCTTAAACTCATTATAATAAAGATTACAAAAATTTCTAAATAACATTAT
AATTTACTATATAAATAAAGAAACTATTCTTGCTGGATATGACAACGAATTAGGTCCTTT
ACTTTATAAGAACGATCCTTCTGGTTACTTCTGTGGTTACAGAGTAATTAAATATTTTTT
ATTTCAAATTTTTAAACTTTTAAAATTCAAAATCTATTTAAAGTAAGTTATATGTAGTGC
TAATGAATGAATAATTTAGTAGGTTTGATAAAATACTTAAATAGCAAATGAATTTTGGTT
TGTTTATAATAGCCATTTTGAAATAAATTTAAATTTTAATCTAATTTTAAATAATTTAAA
GGCTGTTGCATCAGGTATTAAGGAACAAGATGCTATCCATTAATTAGAAAAGGAATTTAA
AAAAGATAAGAACGCCACTTCCATGAGCTTTGATAAAACTATAGAAGTTGCCATCAATAC
TTTAAAAAATGTAATTATCAATATATTTTTTGAATTATATCCACAAATAAATTTATTTAT
TTATTAAATTATTTTATAGATTCTTAACCGTGAATTCAATCCTACTGATATTGAAATTGG
TGTTGTAAGTAAAGAATAACCTAAATTCAAAAAGCTTAACGAATAAGAAATCGAAGAAGC
TCTCAGAAGAACTAACCAATCAAAGTAATGA


>TTHERM_00106960(protein)
MSGSETQITVFSPEGRLFQVEYAQRAVKNSGITTIGVRGKDCVVLITEKKTQESYVDMNS
FTNIHTVSERVGAATTGYYPDSKAIVTRLRQEASEYKLKNGHFMPVDQLSCRLGDLSQVY
TQKAFMRPYAVETILAGYDNELGPLLYKNDPSGYFCGYRAVASGIKEQDAIHQLEKEFKK
DKNATSMSFDKTIEVAINTLKNILNREFNPTDIEIGVVSKEQPKFKKLNEQEIEEALRRT
NQSKQ