Identifiers and Description

Gene Model Identifier

TTHERM_00107200

Standard Name

RAB56 (RAB GTPase 56)

Aliases

PreTt23112 | 7.m00561

Description

RAB56 small GTPase family Rab protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF03029 ) Conserved hypothetical ATP binding protein
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Oxytricha Contig1379.1.g49 8.999890565246037e-26
Description: Ras family
WormBase WBGene00004272 2.0009605191578312e-25
Description: locus:rab-8 status:Confirmed UniProt:G5EFC1 protein_id:CCD68351.1
Tetrahymena borealis EI9_04971.1 6.998020510507768e-25
Description: Ras-like protein Rab11 (207 aa)
DictyBase DDB_G0292406 2.000620012690291e-23
Description: rab4 on chromosome: 6 position 1558648 to 1559514
SGD YER031C 3.9983110956465888e-22
Description: YPT31 Rab family GTPase, very similar to Ypt32p; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00107200(coding)
ATGAGTAGCAACACTTCGTCTTTCAGTCTTTTAGATGAAGTAGAATTAAATGAGCATAGT
AAGCTTAGATTCATTCAAAAAATGAACATCGCGTTACTGGGGAATTCAGGAGTTGGAAAA
ACCTGCATTATTTAATAATATTGTAAAAATGAATTTAGAGATTTAACAGCTATGACATGC
TGCATAGATTTTGCTAAAAAATAATTTGAAGATTTTCTTTTATGCGTTTTTGATACAGCT
GGAAGTGAGAGGTACAGAGGCCTTGCTACTAGTTACCTAAAAAATCAACATGCTGTGATT
ATAGTTTATGATGTTACAGACCCGAAATCAAAAAGAGATGTAATTAACTGGAAGAATATC
GCTGAATCCTTCTCTCCAAGCATTCCAATAATAATTATTGGAAATAAAGTTGATTTAATT
TCTAACGAAGAGCTCAAAAGCATGCAGCAAGAACAAAATGCTTATATCTTTAATAAGACT
TTTTTTACTTCTGCTTTACTAAACTAAGGTCTAGATGATGCATTTAACTACATCATAAAT
CAGGCTAAAAATAAATTAAATCAAAGTGTAATTTGCTCACCTAAAAAATTCAAAAAAAAC
ATTAAAAATGATGAAAATCAAAAAAAAAATGCAAATAATTGCAAATGCTGA


>TTHERM_00107200(gene)
ATGAGTAGCAACACTTCGTCTTTCAGTCTTTTAGATGAAGGTATGAATTAAATAAATAAA
ATCAGTTTAGCAAAAACTGTTTTCAAGAAGAATAAAAGCAAAACATTTTAAATTGAAGGT
CATATTGAGTTTATATAAAAATATATATTCTAAAACATAAAAAAATTGCTCTAATATTGC
CTGATTTGTTTGTTTTAATATTTTAAATTGTAACATATGAAATATTTTTATATCGTTTTA
TATTAAAATATAAATAGTAGAATTAAATGAGCATAGTAAGCTTAGATTCATTCAAAAAAT
GAACATCGCGTTACTGGGGAATTCAGGTAGATATTTTATTATAGTTGCAGTTTTTGAAAA
AAATTAGTAAATTGGATTGACTAGCTTACTAGAAATTTATCTGTTATTTACTCATATAAT
ATTATTAATTTAAAAGGAGTTGGAAAAACCTGCATTATTTAATAATATTGTAAAAATGAA
TTTAGAGATTTAACAGCTATGACATGCTGCATAGATTTTGCTAAAAAATAATTTGAAGAT
TTTCTTTTATGCGTTTTTGATACAGTAATTTTTTTATCTATTTTTTTAAAATAATTTAAA
ACTTCTTTCATAGCTAATTAAATTTAAAAATAAATAGGCTGGAAGTGAGAGGTACAGAGG
CCTTGCTACTAGTTACCTAAAAAAGTAATAAATATTTCTTAATTTTCAAAATATTTATTT
TATCATAAAAGCCTAAAAAACAAATATCATAAATAAGTGAGTAAACTGATAATTAATAAA
TGATTTTCTCCTATAAAAAGCTTTGAATTGTTCATTTAACACTTGAATTATTAGTTATGA
ATTTTTTTATTGAAAAAGTCAACATGCTGTGATTATAGTTTATGATGTTACAGACCCGAA
ATCAAAAAGAGATGTAATTAACTGGAAGAATATCGCTGAATCCTTCTCTCCAAGCATTCC
AATAATAATTATTGGAAATAAAGTTGATTTAATTTCTAAGTAAATTCATGATTATCTAAA
GTAGATAGATAGAATATATAATTATTTTATTTAATATTAAAAATAGCGAAGAGCTCAAAA
GCATGCAGCAAGAACAAAATGCTTATATCTTTAATAAGACTTTTTTTACTTCTGCTTTAC
TAAACTAAGGTCTAGATGATGCATTTAACTACATCATAAATCAGGCTAAAAATAAATTAA
ATCAAAGTGTAATTTGCTCACCTAAAAAATTCAAAAAAAACATTAAAAATGATGAAAATC
AAAAAAAAAATGCAAATAATTGCAAATGCTGA


>TTHERM_00107200(protein)
MSSNTSSFSLLDEVELNEHSKLRFIQKMNIALLGNSGVGKTCIIQQYCKNEFRDLTAMTC
CIDFAKKQFEDFLLCVFDTAGSERYRGLATSYLKNQHAVIIVYDVTDPKSKRDVINWKNI
AESFSPSIPIIIIGNKVDLISNEELKSMQQEQNAYIFNKTFFTSALLNQGLDDAFNYIIN
QAKNKLNQSVICSPKKFKKNIKNDENQKKNANNCKC