Identifiers and Description

Gene Model Identifier

TTHERM_00112610

Standard Name

REX2 (RNA exonuclease REX2)

Aliases

PreTt27075 | 8.m00335 | 3812.m02373

Description

REX2 oligoribonuclease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03952.1 3.9998808708412595e-103
Description: exonuclease (228 aa)
Oxytricha Contig10568.0.g83 8.001227934218267e-54
Description: Exonuclease
WormBase WBGene00007429 5.0020095550341075e-51
Description: Probable oligoribonuclease status:Confirmed UniProt:Q17819 protein_id:CAA96590.1
DictyBase DDB_G0273355 2.000214949834694e-50
Description: rexo2-1 on chromosome: 2 position 2683400 to 2684488
SGD YLR059C 3.999458587140588e-43
Description: REX2 3-5 RNA exonuclease; involved in 3-end processing of U4 and U5 snRNAs, 5S and 5.8S rRNAs, and RNase P and RNase MRP RNA; localized to mitochondria and null suppresses escape of mtDNA to nucleus in yme1 yme2 mutants; RNase D exonuclease
Stentor Coeruleus SteCoe_33446 2.3195228302435696e-16
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112610(coding)
ATGGATAGTTAAGAGTAAAAAATTAAGTTGAAGGATCCTCTTTTATGGTGTGATTGTGAA
ATGACTGGTTTAAATTTTTTGAATAATGATTAAATTATAGAAATAGCAACTCTTTTAACT
GATGGTGAATTGACTTAAGTCATCAAAGGTCCTGAGTTAATTATCTAAGCCCCAAAAGAA
CTACTTGAATCTATGGACGAATGGTGCACAAACACTCATAAAGGCAGTGGATTATATGAC
AAAGTTTTAAAAAGTGAAGTCACTTTATAGATGGCTGAAGAATAAGTTATTAAATTTTTA
AAAGATAATGGAATTGAATAAAAAGAAGCTTTATTGGCAGGAAATTCTATACACGCAGAT
ATGAAATTCATTTAAAAATAAATGCCTAACCTTTATAATTTTTTGCATTACAGACTTGTA
GACGTTTCAACTGTAAAGGAGCTAACCAAGAGATGGAATCCCGAAATATTAAAAAAGGCA
CCTGTCAAAAAAGGCGGACATAGAGCTCTAGACGATATTCTTGAAAGCATAGAAGAGTTA
AAATTTTACAGAAAAGAAGTTTTTAAGATTTGA


>TTHERM_00112610(gene)
ATGGATAGTTAAGAGTAAAAAATTAAGTTGAAGGATCCTCTTTTATGGTGTGATTGTGAA
ATGACTGGTTTAAATTTTTTGAATAATGATTAAATTATAGAAATAGCAACTCTTTTAACT
GATGGTGAATTGACTTAAGTCATCAAAGGTCCTGAGTTAATTATCTAAGCCCCAAAAGAA
CTACTTGAATCTATGGACGAATGGTGCACAAACACTCATAAAGGCAGTGGATTATATGAC
AAAGTTTTAAAAAGTGAAGTCACTTTATAGATGGCTGAAGAATAAGTTATTAAATTTTTA
AAAGATAATGGAATTGAATAAAAAGAAGCTTTATTGGCAGGAAATTCTATACACGCAGAT
ATGAAATTCATTTAAAAATAAATGCCTAACCTTTATAATTTTTTGCATTACAGACTTGTA
GACGTTTCAACTGTAAAGGAGCTAACCAAGAGATGGAATCCCGAAATATTAAAAAAGGCA
CCTGTCAAAAAAGGCGGACATAGAGCTCTAGACGATATTCTTGAAAGCATAGAAGAGTTA
AAATTTTACAGAAAAGAAGTTTTTAAGATTTGA


>TTHERM_00112610(protein)
MDSQEQKIKLKDPLLWCDCEMTGLNFLNNDQIIEIATLLTDGELTQVIKGPELIIQAPKE
LLESMDEWCTNTHKGSGLYDKVLKSEVTLQMAEEQVIKFLKDNGIEQKEALLAGNSIHAD
MKFIQKQMPNLYNFLHYRLVDVSTVKELTKRWNPEILKKAPVKKGGHRALDDILESIEEL
KFYRKEVFKI