Identifiers and Description

Gene Model Identifier

TTHERM_00112930

Standard Name

TGL3 (TriGlyceride Lipase)

Aliases

PreTt27107 | 8.m00367 | 3812.m02404

Description

TGL3 ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03927.1 9.997093137033517e-262
Description: ab-hydrolase associated lipase region family protein (405 aa)
Oxytricha Contig10401.0.g79 4.998071612500574e-77
Description: Partial alpha/beta-hydrolase lipase region
DictyBase DDB_G0276083 2.000597631390999e-64
Description: lip4 on chromosome: 2 position 6415536 to 6416900
WormBase WBGene00021963 1.9999167998962255e-60
Description: locus:lipl-6 status:Partially_confirmed UniProt:E2S7J2 protein_id:CCD72909.1
Stentor Coeruleus SteCoe_30108 6.639677199580735e-36
Description: None
SGD YKL140W 9.004486704249587e-32
Description: TGL1 Steryl ester hydrolase, one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112930(coding)
ATGGGCATTAAAGTGATTATTTTAACTGTAGCATTGCTTTCTCTAAGCAATTGCTTCTTC
CCTACAAAAACTCCTATAGACTTAAATCATCTTCCTGCTCTCACAAATATGACCTTTCCT
GAAGCTATGAATTACTTAAATTACCCTGTAGAAACTCACTATATCACTACTCAAGATGGA
TATATCCTAACTTTCTTTAGAATTCAAGCCAAGAATACTACTATTAAGAGCGGATTACCT
GTTGTTTACTTCTAACATGGACTTGAAGATAGCTCAGATACCATATGCTTAAATGATGAA
GAAAATGCTCCAGGTTTATTGATTGCTAATGAAGGTTATGACTTATGGTTGGGTAATAGT
AGAGGTAACAGATATAGTTTAAATCATACTAAATACACTACTTCTGATAAATAATTTTGG
TAATTCACTTTCTAACACATGGGTGAATATGATGTCCCAGCTGCTTTTGAGTATATTTCA
AAGGCTACTAATCAAAAAATTAACTATATTGGACACTCTTAAGGTACTATTCAAATGTTT
GTCGCTTTGTCTAGACATGAAAAGAAAGTCTTAAACAATTTAAAGAGTTATATTGCTCTT
GGACCTGTAGCTTGGGTTGGTTAAATTAAATCAGTTCTTTTACGTTCTATGGGTGAAAGT
AAGCCATTAATTGACGCAATTATTGCTACTGGAATTTAGCAATTCCTCCCTTATAAGTAA
GAAGAAGTCTTACCTTTACTTTGCACATATGTTCCTCAATTATGTGGTTTAACTTTAGAA
GCCTTAATGGATATGAATGACTCTTATGATAACTTAAAGAGAATGAACATTTTTGTTGGC
CATCTTCCAGCAGGCACTTCTACCTTAAATATGAGACATTGGGCATAGAACATCCGTAGT
AAGGAATACAGATACTTCGATTATGGAACAGCAGGAAATTATTTACATTATGGATAAGCC
AAAGCACCTAAAATTGAAGTTGAAAAAATTAATGTACCTGTCCATTTATTTGTTGGCCAA
ACTGATGAACTCGCTGATGTTAGTGATGTTGAAATTCTTAGACAAAATCTCATAGGTTCT
CCTAATGTAACATACAATTTATATCCTTTCGGACATGCTTCTTTCTTGATTGGCAAAAAT
GTGACATTCATGAATGATGTATTCGCTGTCCTTAATGACTATAATCAAAAGGAAACCAAA
ATTTAATTCTGA


>TTHERM_00112930(gene)
ATGGGCATTAAAGTGATTATTTTAACTGTAGCATTGCTTTCTCTAAGCAATTGCTTCTTC
CCTACAAAAACTCCTATAGACTTAAATCATCTTCCTGCTCTCACAAATATGACCTTTCCT
GAAGCTATGAATTACTTAAATTACCCTGTAGAAACTCACTATATCACTACTCAAGATGGA
TATATCCTAACTTTCTTTAGAATTCAAGCCAAGAATACTACTATTAAGAGCGGATTACCT
GTTGTTTACTTCTAACATGGACTTGAAGATAGCTCAGATACCATATGCTTAAATGATGAA
GAAAATGCTCCAGGTTTATTGATTGCTAATGAAGGTTATGACTTATGGTTGGGTAATAGT
AGAGGTAACAGATATAGTTTAAATCATACTAAATACACTACTTCTGATAAATAATTTTGG
TAATTCACTTTCTAACACATGGGTGAATATGATGTCCCAGCTGCTTTTGAGTATATTTCA
AAGGCTACTAATCAAAAAATTAACTATATTGGACACTCTTAAGGTACTATTCAAATGTTT
GTCGCTTTGTCTAGACATGAAAAGAAAGTCTTAAACAATTTAAAGAGTTATATTGCTCTT
GGACCTGTAGCTTGGGTTGGTTAAATTAAATCAGTTCTTTTACGTTCTATGGGTGAAAGT
AAGCCATTAATTGACGCAATTATTGCTACTGGAATTTAGCAATTCCTCCCTTATAAGTAA
GAAGAAGTCTTACCTTTACTTTGCACATATGTTCCTCAATTATGTGGTTTAACTTTAGAA
GCCTTAATGGATATGAATGACTCTTATGATAACTTAAAGAGAATGAACATTTTTGTTGGC
CATCTTCCAGCAGGCACTTCTACCTTAAATATGAGACATTGGTAAATATTCATTTATTAA
ATTTTTAATGAATAAGATAAAGTCTTAGTTATTTCGAAAAGTGCAATATAAAGAGATAAA
GTTTTGTTTATACAATTAATAAACTGGCAATTAAGAATTCAAATTAGGCTATAAAAAGTG
TTCAAAAAAAAATTTTTATTACATCACTTATGTCAGTTTTGATAAATCAAAATTTATGAA
ATTTTAGAGTAATTTATCTAATAATTAGATTTTAATTCCAAAGAAATTTAGTTACTCACA
AATTAAAATTTAATTATTAATTTAAAGACTAATTGAATGATTAATATGAATATCCAAAAA
ATTTATAATCTAAAATTTATTCTTTTATATATAAATAGGGCATAGAACATCCGTAGTAAG
GAATACAGATACTTCGATTATGGAACAGCAGGAAATTATTTACATTATGGATAAGCCAAA
GCACCTAAAATTGAAGTTGAAAAAATTAATGTACCTGTCCATTTATTTGTTGGCCAAACT
GATGAACTCGCTGATGTTAGTGATGTTGAAATTCTTAGACAAAATCTCATAGGTTCTCCT
AATGTAACATACAATTTATATCCTTTCGGACATGCTTCTTTCTTGATTGGCAAAAATGTG
ACATTCATGAATGATGTATTCGCTGTCCTTAATGACTATAATCAAAAGGAAACCAAAATT
TAATTCTGA


>TTHERM_00112930(protein)
MGIKVIILTVALLSLSNCFFPTKTPIDLNHLPALTNMTFPEAMNYLNYPVETHYITTQDG
YILTFFRIQAKNTTIKSGLPVVYFQHGLEDSSDTICLNDEENAPGLLIANEGYDLWLGNS
RGNRYSLNHTKYTTSDKQFWQFTFQHMGEYDVPAAFEYISKATNQKINYIGHSQGTIQMF
VALSRHEKKVLNNLKSYIALGPVAWVGQIKSVLLRSMGESKPLIDAIIATGIQQFLPYKQ
EEVLPLLCTYVPQLCGLTLEALMDMNDSYDNLKRMNIFVGHLPAGTSTLNMRHWAQNIRS
KEYRYFDYGTAGNYLHYGQAKAPKIEVEKINVPVHLFVGQTDELADVSDVEILRQNLIGS
PNVTYNLYPFGHASFLIGKNVTFMNDVFAVLNDYNQKETKIQF