Identifiers and Description

Gene Model Identifier

TTHERM_00112980

Standard Name

CTH10 (CaTHepsin 10)

Aliases

PreTt27112 | 8.m00372 | 3812.m02409

Description

CTH10 eukaryotic aspartyl protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03924.1 9.997093137033517e-262
Description: eukaryotic aspartyl protease (389 aa)
DictyBase DDB_G0279411 4.001202823045957e-54
Description: ctsD on chromosome: 3 position 2104523 to 2105867
WormBase WBGene00000217 7.999866353200662e-52
Description: locus:asp-4 status:Confirmed UniProt:Q21966 protein_id:CAA90633.1
SGD YPL154C 7.000028900755185e-46
Description: PEP4 Vacuolar aspartyl protease (proteinase A), required for the posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; synthesized as a zymogen, self-activates
Oxytricha Contig18489.0.g67 2.000364041471746e-45
Description: Eukaryotic aspartyl protease
Stentor Coeruleus SteCoe_20625 1.0806392777072785e-30
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112980(coding)
ATGAAAAAAATATTAGTACTATTAACAATAGTTTACTTAGCCACAGCTTTTATAAAGATC
CCTCTTCGAAGAACTGAAGAAACAGATCTTCCATATAATTAAACATCAAATCAGTCTTAA
TTACAAATGAAAAACTTTCTTTCCCTAAAGTCAAAGTAAATAAATTGGACTGATGAAAGA
ATAGACTTTTATGTTCACTCACAATACTATGGTGACATTTAAGTAGGAACTCCTCCTTAA
AACTTAGGTATCATTTTTGATACTGGCTCTCCTGAATTTGTGATTCTTTCTTCTACATGT
AGTCCTGCTACCTATACTTGTGGAGTTCATAAAAAATATAATCATACATCTTCATCTACA
TACACAGCTGATGGAGAAACATTTGTTGAGCAATATGATGCTGGTTCAATAGCAGGTTTC
AGATCTAATGACACTGTGAGTGTTGGAAATTATACTTTGAAATAGTTCTAAATTGATGAA
GTTTAAAATGTAACAGGATTTATTTTTAAATACTTTAAAACTAGTGGTATTTTTGGTCTT
TCCTACTAGATAGGTAACAGCACTGTTCCTTTTTTCCAGCAATATCTTTAGGAAAATCCT
GGTAGTAATATTTCATATGGTTTTTATTACACTGAAAAGTATGGAGGAGAGGGATCTGCC
CTTTTTATTGGCGGTTTTGATCCATACTATGCTGTTTCTCCTTTCTATTATTATCCTTTG
GTATAGGATGATTTTTGGACTATTGGAATCAATTGTGTTAAATTCTAAAACCAGACTTTT
AATATCAGCTATGCTATTGTAGATTCAGGAACTCCTCTCTTAACAGGACCTAGCATGCTT
ATGAATGCAATTTTCTAAAGTCTTCCTAACAAAGGTGAAAGAATAGTTGATTGTAGCACA
ATTAAATAATACCCTGCGATACATTTCGAAATAGGTAACTAAACTTATACATTAAACGGA
GAAGACTATATATTATAGATAAAAAGTTAAGGATAATATGGATGTCTCTTAGGTTTAAAA
ATAATAGATATTGGTGAGCCAACACCTAACGCTTTAATTTTTGGTGACGTTTTCATGAGA
AAGTATTTTACTAACTTTGATTTAAATGGCAAATAGGTAGGATTTGCTTTAGCTAGAAAA
GATCAAGAAAGAGTTGTTGAGTATTGA


>TTHERM_00112980(gene)
ATGAAAAAAATATTAGTACTATTAACAATAGTTTACTTAGCCACAGCTTTTATAAAGATC
CCTCTTCGAAGAACTGAAGAAACAGATCTTCCATATAATTAAACATCAAATCAGTCTTAA
TTACAAATGAAAAACTTTCTTTCCCTAAAGTCAAAGTAAATAAATTGGACTGATGAAAGA
ATAGACTTTTATGTTCACTCACAATACTATGGTGACATTTAAGTAGGAACTCCTCCTTAA
AACTTAGGTATCATTTTTGATACTGGCTCTCCTGAATTTGTGATTCTTTCTTCTACATGT
AGTCCTGCTACCTATACTTGTGGAGTTCATAAAAAATATAATCATACATCTTCATCTACA
TACACAGCTGATGGAGAAACATTTGTTGAGCAATATGATGCTGGTTCAATAGCAGGTTTC
AGATCTAATGACACTGTGAGTGTTGGAAATTATACTTTGAAATAGTTCTAAATTGATGAA
GTTTAAAATGTAACAGGATTTATTTTTAAATACTTTAAAACTAGTGGTATTTTTGGTCTT
TCCTACTAGATAGGTAACAGCACTGTTCCTTTTTTCCAGCAATATCTTTAGGAAAATCCT
GGTAGTAATATTTCATATGGTTTTTATTACACTGAAAAGTATGGAGGAGAGGGATCTGCC
CTTTTTATTGGCGGTTTTGATCCATACTATGCTGTTTCTCCTTTCTATTATTATCCTTTG
GTATAGGATGATTTTTGGACTATTGGAATCAATTGTGTTAAATTCTAAAACCAGACTTTT
AATATCAGCTATGCTATTGTAGATTCAGGAACTCCTCTCTTAACAGGACCTAGCATGCTT
ATGAATGCAATTTTCTAAAGTCTTCCTAACAAAGGTGAAAGAATAGTTGATTGTAGCACA
ATTAAATAATACCCTGCGATACATTTCGAAATAGGTAACTAAACTTATACATTAAACGGA
GAAGACTATATATTATAGATAAAAAGTTAAGGATAATATGGATGTCTCTTAGGTTTAAAA
ATAATAGATATTGGTGAGCCAACACCTAACGCTTTAATTTTTGGTGACGTTTTCATGAGA
AAGTATTTTACTAACTTTGATTTAAATGGCAAATAGGTAGGATTTGCTTTAGCTAGAAAA
GATCAAGAAAGAGTTGTTGAGTATTGA


>TTHERM_00112980(protein)
MKKILVLLTIVYLATAFIKIPLRRTEETDLPYNQTSNQSQLQMKNFLSLKSKQINWTDER
IDFYVHSQYYGDIQVGTPPQNLGIIFDTGSPEFVILSSTCSPATYTCGVHKKYNHTSSST
YTADGETFVEQYDAGSIAGFRSNDTVSVGNYTLKQFQIDEVQNVTGFIFKYFKTSGIFGL
SYQIGNSTVPFFQQYLQENPGSNISYGFYYTEKYGGEGSALFIGGFDPYYAVSPFYYYPL
VQDDFWTIGINCVKFQNQTFNISYAIVDSGTPLLTGPSMLMNAIFQSLPNKGERIVDCST
IKQYPAIHFEIGNQTYTLNGEDYILQIKSQGQYGCLLGLKIIDIGEPTPNALIFGDVFMR
KYFTNFDLNGKQVGFALARKDQERVVEY