Identifiers and Description

Gene Model Identifier

TTHERM_00113050

Standard Name

CHS6 (CHitin Synthase)

Aliases

PreTt27119 | 8.m00379 | 3812.m02416

Description

CHS6 chitin synthase; Chitin synthase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03920.1 9.997093137033517e-262
Description: chitin synthase (860 aa)
Oxytricha Contig20733.0.g18 4.9986056260133516e-43
Description: Chitin synthase
SGD YNL192W 3.9997566980151843e-38
Description: CHS1 Chitin synthase I, requires activation from zymogenic form in order to catalyze the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for repairing the chitin septum during cytokinesis; transcription activated by mating factor
Stentor Coeruleus SteCoe_24238 1.9287498479639178e-22
Description: None
WormBase WBGene00000497 0.000000009996807949091551
Description: locus:chs-2 status:Confirmed UniProt:G5EBQ8 protein_id:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00113050(coding)
ATGTCTGAAGAATAATCACAATCAAAAAAGAGTTTACCTTAAACTGATTTTGAATTTTAA
TAGTCTAAAGATAATGAAACACTAATAAAAAATGCCCCATTATAAATTGATGAACATTCA
TTATATTAGAAACCATTAGACCTATATATGGTTTGCACAGGTTAAGATGATTTAAATGGT
TAGTTAGAACCATTAAATGTGTATACATAAACTATTTAACCAAAGATTCATCAAATATTT
AACGGATAGGCTTATTACACTTATTTTGATGAAGCATCTTATAGAAACTTAGGATCACTA
AGAAATATAAATGAAAAAGATGGGCTGATAGGTTATTATAGCAGTAAAAAGCAAGGAAAT
ATTCTTCAAATGCTTGTCTGTGTCACTATGTATAGTGAAGAGAGAAACTTTCTTGAATAG
ACTCTTCTTCATATACAAAATAATCTCAAAGGATTTTAAGAACTTGGAGTTTAAGATTTT
TAGGTAGTTGTTGCCGTTATCTATGATGGAATCATGAAAGTAAAAGAAGAAGTTGTTGAT
TTTTATCTTGAAATTGATTCAGAAAATGGTTACAATCTTGATAAAAATTTAAAAAGGAGA
AGAGAAGTTATTTAGAGCTAAATGGACTATCTAACATTTACTAATTAATCTCATCTCTTA
GATACAAATGAAGGTCTTCCCCCAACTATACCTAAATAAATATCTTTATTGTATTAAAAC
AAATTTCAATTATATCTTTAAGATGAAAATAACCGCGATTCTAAAGTATAAATAATTTGC
CCTCAAAATCCTCTATTTGACACTTATCATCCTACCTTAACAGTATTTTCTCTCTTTAAA
CATAAAAATGCAAAAAAGTTATCTTCTCATTTATGGTTCTTTGAAGGTTTGTGTCGTTAA
ACAAGGCCTAAGTATGTTTGCTTTGTGGATGCTGGAACATTACCTTCTTAATATGGTATA
GTCAAATTTTACTAAGCAATGGAGGGAAATTAAACAATAGGAGGAGTATGTGGCTTCTTG
GGATTAGAAGAACCACCTGAAGGAGGAGGAGGATAAAGTAAATCTGATAATGAAAAATTA
GTAAAATTAAAAAAGAATTTGAAATAATTAAAAGAGCTAGCATAAGTCCAAGAATATGCG
ATTGGCCATATCATAGATAAAAACTTTGATTCTTTTTTAGGATTTATGCATGTGCTACCA
GGAGCTTGGTCTGCTTACAGGTATGATGCTCTGGAAGTAAGAAAGGGTGAAAAATCTAAT
TTTATGCAAGATAGCTACTTTAAATCTGTTTTGAATCCTGAGCTATTAACAGATGACATC
AAAGAAGCAAATAAATTTTTAGCAGAAGATAGAATACTTTGTCTAGGTATTATTTCAGCT
AAAGGTTCTAATTACATATTAAAATATGTCCCTGAAGCACTTGCTGTAACAGACTCACCT
GAAACATTAGAAGAATTCATACACTAACACAGAAGATGGACAAACAGCATGATTTTTGCA
CTCAACCATGTTTTATAAAATTATAAAGCCAGTATTTAAGGCATATGCTTGTCATTTAAA
ATGAAAAAATAAAATATTTCTGAGTATTTGAAACTATTTAATTATGTTTTAACATTAGAA
GATAAGTAGAATATATCATCTTACTAGTAACAGCTCAAAGAAAGAAAAAAAACTCCCAAA
TAAATAGAAGCTTGTTCAAATAATTTAATTTTTAAACTTGGAGAAAAAAGATTGAAAGAT
CTTAAAATTATATTTGATTAAAACTAATCACATAAGCTTCCAAAAGATCTTTAGAATATA
AAATCAGAATATGATAGAATATACACACAAAAGCATAATAATAAAGTTTACAAAATATTT
GCTTCTCTTTTTTCCATAGAGGCTTCTATTTTTATGATCATACTCAGTGCTGCTTTATAT
ATCAACTTATTTACTCCAGATATATACTCTGATCTTGGATTTTAAATGCTACCAAAATAG
ATGAGAGGCTATATAATCATAATTTTAATATTTAAAGGGGGTCTTATTTTACTTATTCTA
TTTCTCCATACTATCTTTTAGCCTAAGATATTGTGGTTATTTGTAAAATCTTACTTTTCT
TATATTTTATACTCTCCAGTGTATTAAATATACCTAACAATTTTCTCATTCTGTAATCTT
GATGATGTCACATGGGGTACAAAAGGCTTGCAAAATTCAACACAAAATTAAACATTTTTA
ACTGACAAAGTTAGGTATGTGAAGTATTGGGTGTTTCTGAATTCTTCTTTAATAATAGCA
TTCCTTTGTGCTAGCTTAATACCATTAGATAAAACTCCATATGTGATTATTGGAATAGGT
ATATATGATTCTCTTTACAATTCAGTTAGAATTATAGGTAAATTATATAATATAATTTAT
TAAGTATGA


>TTHERM_00113050(gene)
ATGTCTGAAGAATAATCACAATCAAAAAAGAGTTTACCTTAAACTGATTTTGAATTTTAA
TAGTCTAAAGATAATGAAACACTAATAAAAAATGCCCCATTATAAATTGATGAACATTCA
TTATATTAGAAACCATTAGACCTATATATGGTTTGCACAGGTTAAGATGATTTAAATGGT
TAGTTAGAACCATTAAATGTGTATACATAAACTATTTAACCAAAGATTCATCAAATATTT
AACGGATAGGCTTATTACACTTATTTTGATGAAGCATCTTATAGAAACTTAGGGTAAATA
AAATCTTTAAAACAGTTAAATTTTTAGTATTTCTCGTTTTATTATTTTGTTTATATTTAG
TTTTTTCATCATATTTTTTCCTAATTTTTTATTTATTTATATATTAAATCAATCAATCAA
TATTGATTATTTCTTAGTAATAGGAGTAAGTTATTAAGTAGATAAATATCAAAACAAAGT
ATATTTTTCATACTTAATTAAACAAAAAATTCCAATTATTTTTTCCTTAAAATATTTCGA
CAATAATTATCATATTTCAATATCAAAAATAAATACTTAATTTATTTGAATTATATCTTT
AACCATGAAATTATTTTTAATACTAAAGTTGATAAAAAGTTTAAATGTAAGTGGAGTATT
GTATTCCATTATTTGTCAAAAAGATAATTTAATATTCTAATTTTAATTTAATTATTTTTA
ATAAGTGAATGGTTCATTTTACCAAATTAAGCCATCCTCAATAGAATATTTAATTTTTGC
TCATAATATTTTTATTAAATCACTTTCCAGTAATTTAAGTACAATAAATAACTAATATAA
TGTTTTAAAAATTTTTCTTATGCAATCTTATAAAATCTAATAAAGTTTTTAATTAATCCC
TCAAAATAATATAGATCACTAAGAAATATAAATGAAAAAGATGGGCTGATAGGTTATTAT
AGCAGTAAAAAGCAAGGAAATATTCTTCAAATGCTTGTCTGTGTCACTATGTATAGTGAA
GAGAGAAACTTTCTTGAATAGACTCTTCTTCATATACAAAATAATCTCAAAGGATTTTAA
GAACTTGGAGTTTAAGATTTTTAGGTAGTTGTTGCCGTTATCTATGATGGAATCATGAAA
GTAAAAGAAGAAGTTGTTGATTTTTATCTTGAAATTGATTCAGAAAATGGTTACAATCTT
GATAAAAATTTAAAAAGGAGAAGAGAAGTTATTTAGAGCTAAATGGACTATCTAACATTT
ACTAATTAATCTCATCTCTTAGATACAAATGAAGGTCTTCCCCCAACTATACCTAAATAA
ATATCTTTATTGTATTAAAACAAATTTCAATTATATCTTTAAGATGAAAATAACCGCGAT
TCTAAAGTATAAATAATTTGCCCTCAAAATCCTCTATTTGACACTTATCATCCTACCTTA
ACAGTATTTTCTCTCTTTAAACATAAAAATGCAAAAAAGTTATCTTCTCATTTATGGTTC
TTTGAAGGTTTGTGTCGTTAAACAAGGCCTAAGTATGTTTGCTTTGTGGATGCTGGAACA
TTAGTAAAAATAATTATATTAATTCCCTTTTAAAAATCTTTGTTTTTTCTATTTTAAAAT
TTTATATTTAAAATTAAGCCTTCTTAATATGGTATAGTCAAATTTTACTAAGCAATGGAG
GGAAATTAAACAATAGGAGGAGTATGTGGCTTCTTGGGATTAGAAGAACCACCTGAAGGA
GGAGGAGGATAAAGTAAATCTGATAATGAAAAATTAGTAAAATTAAAAAAGAATTTGAAA
TAATTAAAAGAGTAAGATTAACAGTTATGGGAAGAATAATTTTAAAAGGAGAAACAAAAT
AAATAAAAGGAATAAAAATAAATCAAAATTTATACAACGAGTGAAATTAATCAAATTTTT
GATCAGTTATCAAATAATTTCAGAAATTAAAAGTAGAATCAAATATTCAAAAGAAATTAC
CTTATCACAAACGGAATACTTTTTTTTATTTTCTTTCCCTTTTATCTATCTAAATTTTTA
ATGATTAATGTTTTCTTTAAACTGATTTCTAAGCTTGGATCTCTTGTAGCCAAATTTTTA
GAAAATTTCCTATAAATTTTTGCATCTATAAGGCTAGCATAAGTCCAAGAATATGCGATT
GGCCATATCATAGATAAAAACTTTGATTCTTTTTTAGGATTTATGCATGTGCTACCAGGA
GCTTGGTCTGCTTACAGGTGAAATAAAAAAGTTTTAATTATTTTTATTTATTTTTCATGC
ATTTATTTATAAAAGGTATGATGCTCTGGAAGTAAGAAAGGGTGAAAAATCTAATTTTAT
GCAAGATAGCTACTTTAAATCTGTTTTGAATCCTGAGCTATTAACAGATGACATCAAAGA
AGCAAATAAATTTTTAGCAGAAGATAGAATACTTTGTCTAGGTATTATTTCAGCTAAAGG
TTCTAATTACATGTATCTTGCTTATAAATTTTATAAAGAATGTTTCTTAATCTTCAAATT
AAATTTGTCTATGAATTATAATTTTTGATGATTTTAATTGTGAATAATTTGTAAATTTAA
TTAAAACATAGATTAAAATATGTCCCTGAAGCACTTGCTGTAACAGACTCACCTGAAACA
TTAGAAGAATTCATACACTAACACAGAAGATGGACAAACAGCATGATTTTTGCACTCAAC
CATGTTTTATAAAATTATAAAGCCAGTATTTAAGGCAGTAAGCATTCAAAGTTTTATAGT
AAAATTTGCTTACCTGTTAATATGCTTTTTGCTTATCTTGGATTAGTCAATTATATTATA
TTGCCATCGTTTTTTTTATTTATGGTAATATTATCAGGATATTAATTTTACATTCCATCC
AACATACATGGAATTGCTTTAATTAATGAAAATCTTGCACAAAATAAATGCTAAATAGAT
TATCAACTTAAAGAATTTGATTTACAATGTAATTCTGAAATAAAATCAAATTGCTATTTA
GATTGTTTAACTGGGGAGCTTAACATTTATCAAAAGTAATTTAACACTTTACATATAATA
CCATTAAAAATTATTATCTAAAATTAGGTTTTTTAATATGTTGATGAAAACTCTTCCTTT
TGTTGTAGTAGTAACAGTAATTCTTTTTATGATAGTATGCTTGTCATTTAAAATGAAAAA
ATAAAATATTTCTGAGTATTTGAAACTATTTAATTATGTTTTAACATTAGAAGATAAGTA
GAATATATCATCTTACTAGTAACAGCTCAAAGAAAGAAAAAAAACTCCCAAATAAATAGA
AGCTTGTTCAAATAATTTAATTTTTAAACTTGGAGAAAAAAGATTGAAAGATCTTAAAAT
TATATTTGATTAAAACTAATCACATAAGCTTCCAAAAGATCTTTAGAATATAAAATCAGA
ATATGATAGAATAGTAATTCTTTTTTTATTAATTATAAATAAACTGGATATTTATTTTTT
TTAATTTAAAGTACACACAAAAGCATAATAATAAAGTTTACAAAATATTTGCTTCTCTTT
TTTCCATAGAGGTAAATCATCTTTTTTTTAATTAAATAAAATTAAGCTATTTTCATCAAT
TTTAAAACCATAAAAACACAAAATAAATTTAATAACTTAAAATTAATATTTTTGTAGGCT
TCTATTTTTATGATCATACTCAGTGCTGCTTTATATATCAACTTATTTACTCCAGATATA
TACTCTGATCTTGGATTTTAAATGCTACCAAAATAGATGAGAGGCTATATAATCATAATT
TTAATATTTAAAGGGGGTCTTATTTTACTTATTCTATTTCTCCATACTATCTTTTAGCCT
AAGATATTGTGGTTATTTGTAAAATCTTACTTTTCTTATATTTTATACTCTCCAGTGTAT
TAAATATACCTAACAATTTTCTCATTCTGTAATCTTGATGATGTCACATGGGGTACAAAA
GGCTTGCAAAATTCAACACAAAATTAAACATTTTTAACTGACAAAGTTAGGTATGTGAAG
TATTGGGTGTTTCTGAATTCTTCTTTAATAATAGCATTCCTTTGTGCTAGCTTAATACCA
TTAGATAAAACTCCATATGTGATTATTGGAATAGGTATATATGATTCTCTTTACAATTCA
GTTAGAATTATAGGTAAATTATATAATATAATTTATTAAGTATGA


>TTHERM_00113050(protein)
MSEEQSQSKKSLPQTDFEFQQSKDNETLIKNAPLQIDEHSLYQKPLDLYMVCTGQDDLNG
QLEPLNVYTQTIQPKIHQIFNGQAYYTYFDEASYRNLGSLRNINEKDGLIGYYSSKKQGN
ILQMLVCVTMYSEERNFLEQTLLHIQNNLKGFQELGVQDFQVVVAVIYDGIMKVKEEVVD
FYLEIDSENGYNLDKNLKRRREVIQSQMDYLTFTNQSHLLDTNEGLPPTIPKQISLLYQN
KFQLYLQDENNRDSKVQIICPQNPLFDTYHPTLTVFSLFKHKNAKKLSSHLWFFEGLCRQ
TRPKYVCFVDAGTLPSQYGIVKFYQAMEGNQTIGGVCGFLGLEEPPEGGGGQSKSDNEKL
VKLKKNLKQLKELAQVQEYAIGHIIDKNFDSFLGFMHVLPGAWSAYRYDALEVRKGEKSN
FMQDSYFKSVLNPELLTDDIKEANKFLAEDRILCLGIISAKGSNYILKYVPEALAVTDSP
ETLEEFIHQHRRWTNSMIFALNHVLQNYKASIQGICLSFKMKKQNISEYLKLFNYVLTLE
DKQNISSYQQQLKERKKTPKQIEACSNNLIFKLGEKRLKDLKIIFDQNQSHKLPKDLQNI
KSEYDRIYTQKHNNKVYKIFASLFSIEASIFMIILSAALYINLFTPDIYSDLGFQMLPKQ
MRGYIIIILIFKGGLILLILFLHTIFQPKILWLFVKSYFSYILYSPVYQIYLTIFSFCNL
DDVTWGTKGLQNSTQNQTFLTDKVRYVKYWVFLNSSLIIAFLCASLIPLDKTPYVIIGIG
IYDSLYNSVRIIGKLYNIIYQV