Identifiers and Description

Gene Model Identifier

TTHERM_00113090

Standard Name

CHS4 (CHitin Synthase)

Aliases

PreTt27123 | 8.m00383 | 3812.m02420

Description

CHS4 chitin synthase; Chitin synthase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03917.1 9.997093137033517e-262
Description: chitin synthase (1249 aa)
Oxytricha Contig20733.0.g18 8.00284826019147e-27
Description: Chitin synthase
SGD YBR038W 3.999672240330216e-26
Description: CHS2 Chitin synthase II; catalyzes transfer of N-acetylglucosamine (GlcNAc) to chitin upon activation of zymogenic form; required for chitin synthesis in the primary septum during cytokinesis; localization regulated by Cdk1p during mitosis
Stentor Coeruleus SteCoe_15999 0.0000000000002543665647376923
Description: None
WormBase WBGene00000497 0.00000019998969434520019
Description: locus:chs-2 status:Confirmed UniProt:G5EBQ8 protein_id:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00113090(coding)
ATGAATAAAAAGGTTGATAATTCTTTAAACACTCCTTTTATTGTTGATGAAGGAGAAGAC
GATGATGGTGAATCTTCAAATGTTCCATTCAATCTTAGTGATGTTTTACAAGATTCTTCA
AAAGCTTAAAACGGAAATGGAGATTATTAAATTAAACAACTTCCTTTTAATTATGATTAA
TATTCTTAGTAGCCTGTCTCAAATTAGTAACCCTCTACATAGCCCAGTCTCTCCATTAAA
AAAGAAAAGAGTACTAATCGCAAGCCAGGAACAGTCCACTTTTAAGACAAAAGTCAGGTT
ATTATTGAAGACAACAATGAAAACCACGAAAGCCCAAGAAATTCAAAATAATAATTAGAC
TTAAATTCAAATATTAGTAAAAAGTCTTATAATGAAGAAGTAAGCACAGAAAAAAACAAT
GTTCTGAATTTGAATGATGATGATATTGAAGTTAACTACGGTAAAGGTGAAACTCCTCTC
GATTTGTTCTTAGAAGGTACTTACGAAGATGGTAAGAAAACTACTCTTGACCCTCTTACT
GTTTTCAGACCTAAAGTTAAACCTAAAATATAAGATTTGAAGAATGGATAGTAGACTTAT
GTACACTTCGACGAAAAATCATACTACAACCCAGGTGTCTTAAGATCAATTGATTAGAAT
GATGGGTTCTTGGGTTATTATTCAATGCCATGGACTAAGAAGAACTAAACTTTGAAGATG
TTAGTTTGTGTTACTATGTATTCTGAAGAAAGAGTTTTCTTAGAGCAAACTTTGTACCAC
ATCTTTAAGAATATGAGAGGATTTGAAGAAATTGGTTTAAAAGACTTCTAGATTGTTGTC
GTTGTCATTCAAGATGGTATTACAAAGATGAAAGAAGAAGTTGTTGATTTCTATTGTGAT
TTGGAAGGTTAAAACAGAAACGTAGATAGAAATTTAAAGCTTAGACGTTATGAAATTTCT
AAGCAAGAACAATTTTTATAATACAAAGGTTAATAAAAGGTTTTAGATTCAAATGAAGGT
TTACCTTTAACTATTCCAAAGCGTACAGCACTAGTCTATCAAAATAGACTTTAATTCGTA
AAGGAAAATTAAAATAAAAAGGAAGAAAGACCTAAGGTTTATAGTTCAAATCACTATCAA
TATGACACTTCAAAACCAGGTTTAACCGTTTTCAGTGTCTTTAAGCATAAAAATGCTAAA
AAATTATCTTCCCATATGTGGTTTTTCGAAGGTTTCTGTCGTTAATTCAGACCTAAATAT
TGTGCTCTAGTCGATGTCGGAACTTTGCCTGCTTCAGATGGTTTGCTAAAGTTTTACATA
GCTATGGAAGGAAATTCAAAAGTAGGTGGTGTTTGTGGTTTCTTGGGTTTGGAAGATCCA
CCTGAGTATGACGAATTGCTTGATGAAGCAGAAACACCTCACATGATGGAATTAAATCAA
ATTCTTGATGAAAAAAAGAAGACTTTAGATAATTGGTAGAAGGACTTTGAAGAAAGAAAA
CGCATAGATAAACAAAAGCAAGAACAAAAAAATAGAGAAGAAAACTAGGTTTTTATAAAT
GAAGAATTAGAAGAAAGAAAGAAAAAACATTTTGATAGCAAACACAGAACTCATAAAATA
TTCTAATATACAATTTTCTTACCAGTAATGCTCCTTCAGATTGGAATTGGTCTTGTTTAT
TGGATTATAAGAAAAGCCATCTTTAAAGCTATTTTTAGATTTTTCAGATGGTTTGCAGTC
AATTATTTAGATATATTCGCTAGTTTGAAAAAAGCTTAGCTCTATGAATACACAATGGCG
CATATGGTAGATAAAAATTTCGAATCTTTACTAGGTTTTCTTCACGTGCTTCCCGGTGCT
TGGTCTGCCTATAGATACGAAGCTTTAGAAGTTAAGTTTTCAAATAGATAAAATTTATTG
CAAAGAAAGTATTTTAAGTAATTAGTTAATCCTGATAAATTAGAAGGTAACATCAAAGAA
GCTAATATGTTCTTGGCTGAAGATAGAATTTTATGTTTAGGTATTTACTGCTAACCTGAT
TCAAACTTTACACTTAAATTTATCCCTGATGCTAAGGCTTTCACAGATCCTGTTGGTACT
TTAGAAGAATTCATGAACTAAAGAAGAAGATGGATTAATAGTACTATGTTTGCCTTGGAT
TATGTGCTCAAACATTATTCATTCCACGTTGAAGAAAGTAGCCACTCCAGCACTGAAAAG
GGTTTCTTACTGCCATTTAATATGTTATTCGCTAAAATAGGTGATATTAACTCTTACTTT
ATTCCTGCCTTTTACTTCTTTGTTGCTTTGATGAGTAGTTTCTAGCTTTTGTCACCTGAA
ATATAGAAAGGTTATTCTTATGTTCCTTTTGATGGCGAAACTGTCAAATTTAAGTGCATA
GTTGGTAAAAAAATTGCGGATTACGAAAATGAATGTGATTATGATACTGGTATTTCAGAA
GGCTGTTACCAATAATGTGAATCTACTGCCTATCCAAAAGCTTTCTATGTTACTCTTAAC
TTAATTCCTTTCATTTATATTGTTTGCTTCTTGCTTATTGTTTTTGCAAGTCTTACTTTC
AAAGTTAGAAGATTAGCATAAAATGCTTATGAAAACCTCAGAAGAATGATATTGACTGAT
GAATAAAGAGGTGATATCAAAGCCATGGAAGACAACATTAAAGATTTGGAAGTTTCTATG
TCAAGATTATAGGAAAAGAAAGATATTTAAAAGTAGAAGAAGGAAATCGAAAAGGAAAAA
AGACGTGTCAGAGTTGAAATTTTTAAAGTGACCCAAACCACTTTTGAGATGCTTGTTGCT
AAGATCAGTGAACATCACATTAAGCTATCTCCTTCTGAGAAAAAATTCAAAATTGAATAT
GATAAGATTACTTCTCAGGAATATGCAAATGATATCTTCAAAATTCTTGCTACTGTTATG
TCTTTGATGAGTATTGTAATTATGCTTGTTGTTGGTTTGGCTATTGCTATGAATATATTC
AATAGCGGTTTTGGTATCATTAATGGTTTCGTTAAGTTAGATGGCTGGTTAAGACTTTAT
ATCATTATCATGGTTATCATAAACATGGGATCATTCTTTGGTATTCTATTGGTCCATCTT
TTTATTTAACCCAAATTAGTGTGGTACATCTTTATTTCTTATTGGAGTTACATTGTCTAT
TAGCCTATTTATAACTTTATTTTGATCATCTTCTCTTTCTGTAACATTGACGATGTCACT
TGGGGAACAAAGGGTCTCTCAGATTCTAAAGAAGCTAATAGCTACTATTAAGAAAAAGTT
AAATTTTTGATCAGATGGTTTGCCTCTAACATTGTCCTCCTCTTAGCCTTAATTGGTGGT
AATGTCTTTACTGGAAAGACACCATATATCATTCTCTTTATCGGTCTATATGGTACTGCA
TATCTAGCCATAAAAACAATATTGGCTATAATTAATTATATTAAGTATTTCATCTTCAAT
AAAATCTACTACAAATACCAAATTCACAAAACAAAGAAGAAAAACGAAGAATCTCAAGAA
CTTTTGAAATAAGAATATAACAGATTTATCTCTACTATGGAAAACAACAGATTAAGAAGT
GTTTCTAGATACGACTATCCAATTTATAAATAAAACCCCTCTATTTCTGGATCAATGTAC
TAAGAAAACTTGATCTTCCACTCTAAATTCAATCAGAGAGTTTCTAACTTTTAAGGTATT
GGATCTTCAAGTAATGTAACTGTAAATGTTAATTAACCTAATAACTAGTAACCTTAACAT
CCAACCCTTAACTAAAACTAAACCCCAATTTCTCCTTAACATTCTCAAAAATGA


>TTHERM_00113090(gene)
ATGAATAAAAAGGTTGATAATTCTTTAAACACTCCTTTTATTGTTGATGAAGGAGAAGAC
GATGATGGTGAATCTTCAAATGTTCCATTCAATCTTAGTGATGTTTTACAAGATTCTTCA
AAAGCTTAAAACGGAAATGGAGATTATTAAATTAAACAACTTCCTTTTAATTATGATTAA
TATTCTTAGTAGCCTGTCTCAAATTAGTAACCCTCTACATAGCCCAGTCTCTCCATTAAA
AAAGAAAAGAGTACTAATCGCAAGCCAGGAACAGTCCACTTTTAAGACAAAAGTCAGGTT
ATTATTGAAGACAACAATGAAAACCACGAAAGCCCAAGAAATTCAAAATAATAATTAGAC
TTAAATTCAAATATTAGTAAAAAGTCTTATAATGAAGAAGTAAGCACAGAAAAAAACAAT
GTTCTGAATTTGAATGATGATGATATTGAAGTTAACTACGGTAAAGGTGAAACTCCTCTC
GATTTGTTCTTAGAAGGTACTTACGAAGATGGTAAGAAAACTACTCTTGACCCTCTTACT
GTTTTCAGACCTAAAGTTAAACCTAAAATATAAGATTTGAAGAATGGATAGTAGACTTAT
GTACACTTCGACGAAAAATCATACTACAACCCAGGGTAATATAATAAATACATTTTATTA
ATTTTCCTTGAATGTGCTTTGATAATAGTGGATATATTTATGAATTAAAAATACAGATTA
AGATAAAACCTTTAATTAAACAAATCTCAAAAAAAAAAAAAAAAAATTAAAATTGATGTT
TGATTAGGATAATTAATTTATTTAGAGCCATTCAGAATTTAACATTAATTATTTTTATTA
TTAATTGTAATTAATTCGAGTGAAGATATTTTTTTTTTTTTTTTTCTTTTTGGAGAAAAG
TAAAATAAATTATGATTGAATTGATTGAGCTTTTCATATTTTGTTTTATTAAAAATATTT
TTAAAATTATTTAAATAGTGTCTTAAGATCAATTGATTAGAATGATGGGTTCTTGGGTTA
TTATTCAATGCCATGGACTAAGAAGAACTAAACTTTGAAGATGTTAGTTTGTGTTACTAT
GTATTCTGAAGAAAGAGTTTTCTTAGAGCAAACTTTGTACCACATCTTTAAGAATATGAG
AGGATTTGAAGAAATTGGTTTAAAAGACTTCTAGATTGTTGTCGTTGTCATTCAAGATGG
TATTACAAAGATGAAAGAAGAAGTTGTTGATTTCTATTGTGATTTGGAAGGTTAAAACAG
AAACGTAGATAGAAATTTAAAGCTTAGACGTTATGAAATTTCTAAGCAAGAACAATTTTT
ATAATACAAAGGTTAATAAAAGGTTTTAGATTCAAATGAAGGTTTACCTTTAACTATTCC
AAAGCGTACAGCACTAGTCTATCAAAATAGACTTTAATTCGTAAAGGAAAATTAAAATAA
AAAGGAAGAAAGACCTAAGGTTTATAGTTCAAATCACTATCAATATGACACTTCAAAACC
AGGTTTAACCGTTTTCAGTGTCTTTAAGCATAAAAATGCTAAAAAATTATCTTCCCATAT
GTGGTTTTTCGAAGGTTTCTGTCGTTAATTCAGACCTAAATATTGTGCTCTAGTCGATGT
CGGAACTTTGGTAAAAAACAAACATCATCTTATTTTTTATTTTATTCATCAACAAAAAAA
ACTAAAAATTTATTTTATTTTTTAATAAGCCTGCTTCAGATGGTTTGCTAAAGTTTTACA
TAGCTATGGAAGGAAATTCAAAAGTAGGTGGTGTTTGTGGTTTCTTGGGTTTGGAAGATC
CACCTGAGTATGACGAATTGCTTGATGAAGCAGAAACACCTCACATGATGGAATTAAATC
AAATTCTTGATGAAAAAAAGAAGACTTTAGATAATTGGTAGAAGGACTTTGAAGAAAGAA
AACGCATAGATAAACAAAAGCAAGAACAAAAAAATAGAGAAGAAAACTAGGTTTTTATAA
ATGAAGAATTAGAAGAAAGAAAGAAAAAACATTTTGATAGCAAACACAGAACTCATAAAA
TATTCTAATATACAATTTTCTTACCAGTAATGCTCCTTCAGATTGGAATTGGTCTTGTTT
ATTGGATTATAAGAAAAGCCATCTTTAAAGCTATTTTTAGATTTTTCAGATGGTTTGCAG
TCAATTATTTAGATATATTCGCTAGTTTGAAAAAAGCTTAGCTCTATGAATACACAATGG
CGCATATGGTAGATAAAAATTTCGAATCTTTACTAGGTTTTCTTCACGTGCTTCCCGGTG
CTTGGTCTGCCTATAGGTAACAAACAAATAAACAAATTGCTTTACAACATTTTATAGAAA
TACAATCCTAGAATTTAATTCTTTAACAACTTAATAAAAATGACTCAAATAAATTAATTT
ATTTATCTAAATTTATTTTAATTAATTAATAGATACGAAGCTTTAGAAGTTAAGTTTTCA
AATAGATAAAATTTATTGCAAAGAAAGTATTTTAAGTAATTAGTTAATCCTGATAAATTA
GAAGGTAACATCAAAGAAGCTAATATGTTCTTGGCTGAAGATAGAATTTTATGTTTAGGT
ATTTACTGCTAACCTGATTCAAACTTTACGTAATTAATTTATTGATAAAAAACTTCTTTC
ATTTCAGAAATATATCAACTAAAAGAAAGAAATATATATATAGATAAATAGATAGATAGA
TAAATTTTATAAATAGCAATTAAATATAGACTTATAAATAATATTTATGACTTATATTTT
TTTCAAATTATAGACTTAAATTTATCCCTGATGCTAAGGCTTTCACAGATCCTGTTGGTA
CTTTAGAAGAATTCATGAACTAAAGAAGAAGATGGATTAATAGTACTATGTTTGCCTTGG
ATTATGTGCTCAAACATTATTCATTCCACGTTGAAGAAAGTAGCCACTCCAGCACTGAAA
AGGGTTTCTTACTGCCATTTAATATGTTATTCGCTAAAATAGGTGATATTAACTCTTACT
TTATTCCTGCCTTTTACTTCTTTGTTGCTTTGATGAGTAGTTTCTAGCTTTTGTCACCTG
AAATATAGAAAGGTTATTCTTATGTTCCTTTTGATGGCGAAACTGTCAAATTTAAGTGCA
TAGTTGGTAAAAAAATTGCGGATTACGAAAATGAATGTGATTATGATACTGGTATTTCAG
AAGGCTGTTACCAATAATGTGAATCTACTGCCTATCCAAAGTAAACATAATTTTAAAATA
TTACCAACTAATTAATATTTATTTAATTATTATAAAAATAATAGAGCTTTCTATGTTACT
CTTAACTTAATTCCTTTCATTTATATTGTTTGCTTCTTGCTTATTGTTTTTGCAAGTCTT
ACTTTCAAAGTTAGAAGATTAGCATAAAATGCTTATGAAAACCTCAGAAGAATGATATTG
ACTGATGAATAAAGAGGTGATATCAAAGCCATGGAAGACAACATTAAAGATTTGGAAGTT
TCTATGTCAAGATTATAGGAAAAGAAAGATATTTAAAAGTAGAAGAAGGAAATCGAAAAG
GAAAAAAGACGTGTCAGAGTTGAAATTTTTAAAGTGACCCAAACCACTTTTGAGATGCTT
GTTGCTAAGATCAGTGAACATCACATTAAGCTATCTCCTTCTGAGAAAAAATTCAAAATT
GAATATGATAAGATTGTAAATAAATAAATAAAAATTCAATTTAAAAAATAATATTTTCAT
AAATTTATTCAAAAAGACTTCTCAGGAATATGCAAATGATATCTTCAAAATTCTTGCTAC
TGTTATGTCTTTGATGGTAACTAATTAATTAATTAAACTTTCTTTTGAATAGTAAAAAAT
TTTAATTAATTTATTTATATAAATAAATAGAGTATTGTAATTATGCTTGTTGTTGGTTTG
GCTATTGCTATGAATATATTCAATAGCGGTTTTGGTATCATTAATGGTTTCGTTAAGTTA
GATGGCTGGTTAAGACTTTATATCATTATCATGGTTATCATAAACATGGGATCATTCTTT
GGTATTCTATTGGTCCATCTTTTTATTTAACCCAAATTAGTGTGGTACATCTTTATTTCT
TATTGGAGTTACATTGTCTATTAGCCTATTTATAACTTTATTTTGATCATCTTCTCTTTC
TGTAACATTGACGATGTCACTTGGGGAACAAAGGGTCTCTCAGATTCTAAAGAAGCTAAT
AGCTACTATTAAGAAAAAGTTAAATTTTTGATCAGATGGTTTGCCTCTAACATTGTCCTC
CTCTTAGCCTTAATTGGTGGTAATGTCTTTACTGGAAAGACACCATATATCATTCTCTTT
ATCGGTCTATATGGTACTGCATATCTAGCCATAAAAACAATATGTAAATTACACATTAAA
AGCAAAAAAATAAATAAATATATTAATTAATTTTTTCTATAAAAAAGTGGCTATAATTAA
TTATATTAAGTATTTCATCTTCAATAAAATCTACTACAAATACCAAATTCACAAAACAAA
GAAGAAAAACGAAGAATCTCAAGAACTTTTGAAATAAGAATATAACAGATTTATCTCTAC
TATGGAAAACAACAGATTAAGAAGTGTTTCTAGATACGACTATCCAATTTATAAATAAAA
CCCCTCTATTTCTGGATCAATGTACTAAGAAAACTTGATCTTCCACTCTAAATTCAATCA
GAGAGTTTCTAACTTTTAAGGTATTGGATCTTCAAGTAATGTAACTGTAAATGTTAATTA
ACCTAATAACTAGTAACCTTAACATCCAACCCTTAACTAAAACTAAACCCCAATTTCTCC
TTAACATTCTCAAAAATGA


>TTHERM_00113090(protein)
MNKKVDNSLNTPFIVDEGEDDDGESSNVPFNLSDVLQDSSKAQNGNGDYQIKQLPFNYDQ
YSQQPVSNQQPSTQPSLSIKKEKSTNRKPGTVHFQDKSQVIIEDNNENHESPRNSKQQLD
LNSNISKKSYNEEVSTEKNNVLNLNDDDIEVNYGKGETPLDLFLEGTYEDGKKTTLDPLT
VFRPKVKPKIQDLKNGQQTYVHFDEKSYYNPGVLRSIDQNDGFLGYYSMPWTKKNQTLKM
LVCVTMYSEERVFLEQTLYHIFKNMRGFEEIGLKDFQIVVVVIQDGITKMKEEVVDFYCD
LEGQNRNVDRNLKLRRYEISKQEQFLQYKGQQKVLDSNEGLPLTIPKRTALVYQNRLQFV
KENQNKKEERPKVYSSNHYQYDTSKPGLTVFSVFKHKNAKKLSSHMWFFEGFCRQFRPKY
CALVDVGTLPASDGLLKFYIAMEGNSKVGGVCGFLGLEDPPEYDELLDEAETPHMMELNQ
ILDEKKKTLDNWQKDFEERKRIDKQKQEQKNREENQVFINEELEERKKKHFDSKHRTHKI
FQYTIFLPVMLLQIGIGLVYWIIRKAIFKAIFRFFRWFAVNYLDIFASLKKAQLYEYTMA
HMVDKNFESLLGFLHVLPGAWSAYRYEALEVKFSNRQNLLQRKYFKQLVNPDKLEGNIKE
ANMFLAEDRILCLGIYCQPDSNFTLKFIPDAKAFTDPVGTLEEFMNQRRRWINSTMFALD
YVLKHYSFHVEESSHSSTEKGFLLPFNMLFAKIGDINSYFIPAFYFFVALMSSFQLLSPE
IQKGYSYVPFDGETVKFKCIVGKKIADYENECDYDTGISEGCYQQCESTAYPKAFYVTLN
LIPFIYIVCFLLIVFASLTFKVRRLAQNAYENLRRMILTDEQRGDIKAMEDNIKDLEVSM
SRLQEKKDIQKQKKEIEKEKRRVRVEIFKVTQTTFEMLVAKISEHHIKLSPSEKKFKIEY
DKITSQEYANDIFKILATVMSLMSIVIMLVVGLAIAMNIFNSGFGIINGFVKLDGWLRLY
IIIMVIINMGSFFGILLVHLFIQPKLVWYIFISYWSYIVYQPIYNFILIIFSFCNIDDVT
WGTKGLSDSKEANSYYQEKVKFLIRWFASNIVLLLALIGGNVFTGKTPYIILFIGLYGTA
YLAIKTILAIINYIKYFIFNKIYYKYQIHKTKKKNEESQELLKQEYNRFISTMENNRLRS
VSRYDYPIYKQNPSISGSMYQENLIFHSKFNQRVSNFQGIGSSSNVTVNVNQPNNQQPQH
PTLNQNQTPISPQHSQK