Identifiers and Description

Gene Model Identifier

TTHERM_00125500

Standard Name

KET1 (Fusion of a kinesin and an ER-golgi vesicle tethering protein )

Aliases

PreTt09312 | 9.m00333 | 3699.m00043

Description

KET1 kinesin motor catalytic domain protein; Fusion of a kinesin and an ER-golgi vesicle tethering protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00038 ) Intermediate filament protein
  • ( PF00225 ) Kinesin motor domain
  • ( PF00261 ) Tropomyosin
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( PF02524 ) KID repeat
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF08279 ) HTH domain
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00133 ) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( TIGR00741 ) ribosomal subunit interface protein
  • ( TIGR01609 ) Plasmodium falciparum uncharacterized protein TIGR01609
  • ( TIGR01612 ) rhoptry protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09095.1 9.997093137033517e-262
Description: kinesin motor domain-containing protein (1565 aa)
Oxytricha Contig20289.0.0.g56 4.0002634815779907e-110
Description: Kinesin motor domain
WormBase WBGene00003884 9.000840820639671e-86
Description: locus:osm-3 Osmotic avoidance abnormal protein 3 status:Confirmed UniProt:P46873 protein_id:CCD70204.1
DictyBase DDB_G0280967 4.9989222866409065e-79
Description: kif3 on chromosome: 3 position 4109358 to 4113107
SGD YBL063W 2.9997246065828143e-59
Description: KIP1 Kinesin-related motor protein required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions
Stentor Coeruleus SteCoe_16220 7.667648073722e-53
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00125500(coding)
ATGATTAAGACTGATCAAGAAAATATTTAGGTCTTGGTTCGTATCAGACCTCTCAATTCT
AGAGAAAAAGCTGAAGGAGCCACTCCATGTATGCAAGTTGATAAGAGTAATCCTACCACA
GTAATTATTGATGGTAAAAGCTATAACTATGATTATATTACTGGCTCTGAGACTACTCAA
GAGGATATTTTTCATATAGTTGGTAAACCTGTTGCTCTAGCTTGGTTGGAAGGTTATAAT
GCTTGTATATTTGCTTATGGTCAAACTGGTGCAGGTAAAACCTTCACCATGCAAGGTAAG
GGGCTTATTGAAGAAGGAGCTGAATCTCCAAATAGAGGTCTTTAGCCTAGAGTTTTTGAC
TATGTATTTGGATTGATTAACTCTTTAAAAAAGGAAAACCCTGAAAATGAATATTTAATT
ACATGCAACTACCTTGAAATTTATAATGAATAAATTATGGATTTGCTTGCTGAGCAAAAG
CATGATGCTAATGCTAAACCAGTTTAACTATCAGTTAGAGAAGATTTGAAAAAAGGAGTT
TATGTCGAAAATTTATGTGAAGAAGTTGCAAATTCATCAGAAGATGCTATCAACTTACTA
ATTAAAGGTGCCTCAGCTCGTCACGTTGGAGCTACTAAAATGAATGCAGATTCAAGCAGA
TCTCACTCTGTTTTTTCTTTGAATTTCTAATCTAAAATTGTTTCTAATGGTATGATACAT
GTTAAAAATTCTAAGTTGCATTTTGTAGATTTGGCTGGTTCTGAAAGACAAAAATCTACT
GGAGCAGCTGGAGATCGTCTCAAAGAAGCATCCAATATCAATAAATCTTTAACCGTTCTT
GGTTTGGTTATTAATGCTTTAGTCGAATCTGCTAATGGTAAAAGTAGACACATTCCTTAC
AGAGACAGTAAATTGACTTTCATTTTGAAAGACTCACTTGGAGGTAACTCAAGAACATTT
ATGATTGCTGCATGCTCAGAAGCCAACACATAATTTTAAGAAACCCTTTCTACTCTTAAG
TTTGCTCAAAGAGCTAAGATGATTAAAAATAAGGCTTCCGTTAACGAAGAAAGTTAAGGA
AATGTTTAGCAGCTTAAAAAAGAAATTTAAAAGCTTAAAGAAGAGTTGTAAGATGCTAAG
AAAGCTTTATAAGAAATGGAGGAAAACTAAAAGAATATGACTAGAATTATAACACCTGCT
AAATATACTCCAACTTCAATGAACCATGAGGCAGTTATTTAATTTTAACAGAAAAACTTT
AAAGAAATTAATATCAAACTTGAAGAAGTCAATTAACTTTTAAGCGATTTTAATGATTCT
AGATCTAGAATCGAAGAATTCTTTAAAAATGAAAAATTGGGAGTTTTAAGAGTCTTCTAA
GATATAGTTGACCAAAAGAAAATGGGATAAGATGTTGATATAATTAAAGCATTAACTTAA
AAATCAGATATGGAAGAGGAAGGAATTAGTTCTTTATTAACTGAAATAGATTAAACGATT
GTAGAAGACATTTAGTAAATGACACAGACATGCATTAAGTTAGAAGAATTTGAAGAAAGA
AGAAAAGATTTTACATCTAAGTTAGAAAAAATAGGATTAATGAACTTTGGATGTCCTGAA
AAAGAGAAAGAACTTGAAGAAGCTATCATTTAAAGAGAAAAAAGAATTATCGAACTTTAA
AATGAACAGGCTCATTAGAATAAGCTGTTTAATTAATAATTAGAGGAAATTTCTAATTAA
AGAGATCATTTTAAAGAAGTAAATCAAGGATTAAACAGTGAAATTTAATCTCTTTAGCAA
TAGATTGCCAAGAATGTCTAAACTCATGAAGAAAAAATTTAACAGTTTAAGAATGGTTTT
GAAAGTAAATTAGCAGAGTATGACTAAAATTCATCTGAGATAAAGATTAAAAATATGGAA
TTAGCCGATGAAATTGATGAATTAAAGTCTCACATTGAGAATCTTAATAGAATTAAAGAT
GATATTAAATAGAAATGGGAAAATGCCTATGAAAATTATCAGAAGACATTACAAACTAAA
AATGAAATAGAAAATTAGAAGGACTCAATTTAATCTTAATTAAATATTTCAAGAGAGGAA
AATACAAACTTAATGTTTAAGTTAAGTGAGGCAGAGAATTTATACAATTAAGACCGTCTA
CACATGATGACTTTAGAAGATGAGCTAAATTCCTAAAAGAATATAATATAAGAAAAAGAT
CATTAAATAAATAATCTTGTCAGTAGAATTGAAGAAGAAAACCTTCGTCTTCAAGCAACT
ATTGATAAATAAAAGGATGACATTGCAAGCTTGGAAGATCAAATTACAAAATCAAAAGAA
GATATAGAAATTGCTTGTCAGACATTAGAGTTCTTGAATAAATAATTAGAAGAGAAATGC
TAAGTAAATATCTAATTATAAGAAACATACAAGCAAGAGTTTAATTAAAGAGAAAAGTTT
GAAAATGAATTGAAATACCTTTACCATAATGAAAAGAGTTAGCTTAACGTAGCTCTTAAA
CAAAATGAAATTTTTGAAAAATAGATTTAGGAAATTGAGCAAGAAATCACCTAAAAGATG
GATAAAATTACTGATTTAGAGCATGATATTTTGGGTCTTTAGGAAAAGCTTAAAAATAAT
GAAAAGCGCCTGAACAGTTTAGAAGTCGAAAAAGAATATTACCGCAATGAAACAGAATAA
TAGATTCAGTAGATTTAAATTAAAGATGATAAAATTAAAGAAATAAATCAAGCCTTAGAA
ACTGCTTTATAAATGGGTGAATAACTAGAAATGGGTGTCTAAGAATATGAAAAATAAAAT
AAAATTCTAAGCGAATAATTGCTTTAGAAAGAGTAAGAAATATTAGAAAAAATTTTATAA
TTGGAAGATGCAGAATAGAAGATAAGAGTATCTCAAATGACTCACGAATTGCTTACTTAA
AAGATTTCAGAATTAGAGAGTTAGTTAGGAGAACAAATTACTTTGAATACAGGCTTTTAA
GATTAAATTGTGTTATTATCAGAAGAAAAGAAGGACCTAATTTAAAAAGAAGCTTAGTTG
ATTGAATCTAATTTAGAATAAGAAAAAACCATAATTGAGTTGAAGGAAAATTTACAATAA
TTGGAGTAATTGTGCAAGGAAAAAGAAACATAAATAGAGTAAATTAAATCTGATTTCTAT
GAACTAAAGAAGTCTTCAGAGGATTACTAGTAGATTTAAGATCATGAGCTAAAATCTGTC
AAAGAGCAGAATAACAAACTTAATGAATAAGTGTAAAACTATGAATTTGAGGTATAAAAC
ATGTAATAGAAGGCTTCTCAAATGGAAGAAGACATGGAAGTCTTAAAGTAAGAAATATAA
GAAAAGCAAGAGCTCTACCTTCAAAGTGAAAAATCAAAGGAGGAACAGATCTCATAAAAA
AATCAAAAGATAGAAGAACTCATTTAAGAAAGATAAGTCTATGAAGAAGAATTCGATAAA
ATTTAAACTAAATATTCAAACCAAATGCGTAATATATCTGAACTTCAACAATCATTTTAA
GCAGCCAGAACTGAAAATGAATCTATTAAAAAACAAATCGAAGATAATAGAGGATAAATG
GAGATCTTCTAATTAGAGAAATAAAAGTTTGAAATAGAGAAACAAAAGCTTGAAACTGAA
AGACAAACTATCTAATAAGAAATGTATTAGAAAGATATCCTCATTTAAAAATTCAAAGAA
GAATAAGAACAAATAGGATGCAAGTTTGAAATATTCAAGACCTTACACGAGTAAATAGAA
GAATAAAAGAATGTTTATCAGTCTAAATATGTCAATAAAAGTAAAGAGCTTGATAATTAC
GAATAAAAATACAATACCCTTGAATAAGCTATGGAAAGACTTAATGAAAAACTTACTATA
AAATAATTGGAAAATAACAAACTAACTAACTAGATTCTTATTATGCAATCCAATAGAGAG
AAAAACTAATTTACATAAGAAGACTTGTAAAGAGATTTGAAAAAATCAAGAGAAGAATGC
TCTCAGATCAAACAAAAATACAAGGCTCTTATATTGGAAAGATAAGTCTAATCACAATAA
GCTAACAGATTTAATGGAAATGCTAATGATCAAAACATCATAATTAAAAAATTAGAGGAA
GAGAACAATAAAATTAAGGATTAATTTAATAAATACAAGCAAATATCAGAAAAAAAGATA
AATGAAATATGTGAAAAGCTTAATAGAGGAATATCCACTGCAACCATAGTCAAAGATATT
TCTAACTCGACTGAGATAGCCAAGAAATTAGAAAAATAATGTGAAATTATAAATGAAAAA
AACATGGGAATATTAGAGATAAATATTCTAGTAAGAAACTATCTTATAGATTGCAAGAAG
GGATAAATTGATCCTACTTAAAAAGACGAATATCTTGAAAAAATTTAATCTTAAGAAGAT
ACTACTGCTCTAAAAGAGGTTCTTTCAAGTGTTTTGAAGAGTGTTGAGGAAAGAGAAAGA
AAGGTATAACAAGAAATGTATTAGTTAAAAGAAAAGAAGGCCTCATATGAATATTATAGA
TCTAAGTGTGAGGAACTTGAATTCAGATACGAGAAGAAGAATTCTGAAACGGGTGAGAAA
ATTCTTAACAGAAAAAGAAAATTGAGCGTAAAAGAAAATGAGGTACCAATTTTAGGTGAG
ATAGATTTAAATAAAAAAGTAAAAGCAAATTTTTGA


>TTHERM_00125500(gene)
ATGATTAAGACTGATCAAGAAAATATTTAGGTCTTGGTTCGTATCAGACCTCTCAATTCT
AGAGAAAAAGCTGAAGGAGCCACTCCATGTATGCAAGTTGATAAGGTAAAATACATACTT
TTTATTTCTTAAAACTGCATTTTAATATTGTTTATTAACATTACTTAAAAATAAAAATTA
GAGTAATCCTACCACAGTAATTATTGATGGTAAAAGCTATAACTATGATTATATTACTGG
CTCTGAGACTACTCAAGAGGATATTTTTCATATAGTTGGTAAACCTGTTGCTCTAGCTTG
GTTGGAAGGTAAACATTTTTTCTTGTCTACAACATTAGTAGAATAATGTCAAAAATAGAT
ATATGAAATTTGACATAAATAAAGAGCATTGTTTTATTTTTCTCCATGTTAAAATAGGTT
ATAATGCTTGTATATTTGCTTATGGTCAAACTGGTGCAGGTAAAACCTTCACCATGCAAG
GTAAGGGGCTTATTGAAGAAGGAGCTGAATCTCCAAATAGAGGTCTTTAGCCTAGAGTTT
TTGACTATGTATTTGGATTGATTAACTCTTTAAAAAAGGAAAACCCTGAAAATGAATATT
TAATTACATGCAACTACCTTGAAATTTATAATGAATAAATTATGGATTTGCTTGCTGAGC
AAAAGCATGATGCTAATGCTAAACCAGTTTAACTATCAGTTAGAGAAGATTTGAAAAAAG
GAGTTTATGTCGAAAATTTATGTGAAGAAGTTGCAAATTCATCAGAAGATGCTATCAACT
TACTAATTAAAGGTAAAAAATGACACTATTATCTATTAATATCTATTTAAGAATATACAA
AATCAATAAATAGGAAATTTAATTTCGAAATCAGCCACAGTGAGCATTTTTTTTATTTCT
CAAAAAATAAGATAAAAGGGGTTTGTTAATTACATCAAACAACTCTTTTATTTTAATTTA
AATTTTCAAATTTTACCTCAATATTTTAATGTGAAATTTGCATTTTTATCTATTTATTTA
TTGATATTTGTAGAAAATATTCATAAATCAAGTTTGAATTATTCTAACTAGAATATTTTC
TTAATGCATCAATTGAAAAGCAATTTATTACAATCATTTATAGCTGAAATAATATCAAAA
ATAAAATATTTCACTTCAGTTTTATTAAATTTGCTTTAAAAGCATTAAAAAAAAACTTGT
TTGAAGTTAAAAAAATAAATTTGAAATTTTAGAAAAAATAAACCATTTTTACCTATTAAT
AAGATAACAAATCGAAATTTAAATGTTATTTTATATTTTATTATAAAAGGTGCCTCAGCT
CGTCACGTTGGAGCTACTAAAATGAATGCAGATTCAAGCAGATCTCACTCTGTTTTTTCT
TTGAATTTCTAATCTAAAATTGTTTCTAATGGTATGATACATGTTAAAAATTCTAAGTTG
CATTTTGTAGATTTGGCTGGTTCTGAAAGACAAAAATCTACTGGAGCAGCTGGAGATCGT
CTCAAAGAAGCATCCAATATCAATAAATCTTTAACCGTTCTTGGTACTAAACTGAATTTA
TAGAAAAACATATTTTAAAAATAAAAACTATTAAATAGGTTTGGTTATTAATGCTTTAGT
CGAATCTGCTAATGGTAAAAGTAGACACATTCCTTACAGAGACAGTAAATTGACTTTCAT
TTTGAAAGACTCACTTGGAGGTAACTCAAGAACATTTATGATTGCTGCATGCTCAGAAGC
CAACACATAATTTTAAGAAACCCTTTCTACTCTTAAGTTTGCTCAAAGAGCTAAGATGAT
TAAAAATAAGGTATTTTATTTGTTAAATACTAAAACTAAATTTGTATTAATATATTAAAA
TTTTAAAAACAGGCTTCCGTTAACGAAGAAAGTTAAGGAAATGTTTAGCAGCTTAAAAAA
GAAATTTAAAAGCTTAAAGAAGAGTTGTAAGATGCTAAGAAAGCTTTATAAGAAATGGAG
GAAAACTAAAAGAATATGACTAGAATTATAACACCTGCTAAATATACTCCAACTTCAATG
AACCATGAGGCAGTTATTTAATTTTAACAGAAAAACTTTAAAGAAATTAATATCAAACTT
GAAGAAGTCAATTAACTTTTAAGTAAATTTTAAAAAATTATAATATGAATTATTTATTTA
AACAAAATAAATACTTGATAACTAATTTATTTTTATTTAGGCGATTTTAATGATTCTAGA
TCTAGAATCGAAGAATTCTTTAAAAATGAAAAATTGGGAGTTTTAAGAGTCTTCTAAGAT
ATAGTTGACCAAAAGAAAATGGGATAAGATGTTGATATAATTAAAGCATTAACTTAAAAA
TCAGAGTAAATAAAGCTTATTTTTTTGATAAAATATCAATTAAATAATAATTAAAATATG
ATAGTATGGAAGAGGAAGGAATTAGTTCTTTATTAACTGAAATAGATTAAACGATTGTAG
AAGACATTTAGTAAATGACACAGACATGCATTAAGTTAGAAGAATTTGAAGAAAGAAGAA
AAGATTTTACATCTAAGTTAGAAAAAATAGGATTAATGAACTTTGGATGTCCTGAAAAAG
AGAAAGAACTTGAAGAAGCTATCATTTAAAGAGAAAAAAGAATTATCGAACTTTAAAATG
AACAGGCTCATTAGAATAAGCTGTAAAGAAAATAAGAATGATATAACGAGAATAACTGTT
TTTTTTAATAATTAGGTTTAATTAATAATTAGAGGAAATTTCTAATTAAAGAGATCATTT
TAAAGAAGTAAATCAAGGATTAAACAGTGAAATTTAATCTCTTTAGCAATAGATTGCCAA
GAATGTCTAAACTCATGAAGAAAAAATTTAACAGTTTAAGAATGGTTTTGAAAGTAAATT
AGCAGAGTATGACTAAAATTCATCTGAGATAAAGATTAAAAATATGGAATTAGCCGATGA
AATTGATGAATTAAAGTCTCACATTGAGAATCTTAATAGAATTAAAGATGATATTAAATA
GAAATGGGAAAATGCCTATGAAAATTATCAGAAGACATTACAAGTAATTATTTATTTAAT
CAGGTTATTGATGGAATATTAATTTTTTTAAAAATAATTTCTTTAGACTAAAAATGAAAT
AGAAAATTAGAAGGACTCAATTTAATCTTAATTAAATATTTCAAGAGAGGAAAATACAAA
CTTAATGTTTAAGTTAAGTGAGGCAGAGAATTTATACAATTAAGACCGTCTACACATGAT
GACTTTAGAAGATGAGCTAAATTCCTAAAAGAATATAATATAAGAAAAAGATCATTAAAT
AAATAATCTTGTCAGTAGAATTGAAGAAGAAAACCTTCGTCTTCAAGCAACTATTGATAA
ATAAAAGGATGACATTGCAAGCTTGGAAGATCAAATTACAAAATCAAAAGAAGTAAACAT
AGTCTTTGATTTTCATAAATGAAATTAAAATTTAATAAAAATAATTTAGGATATAGAAAT
TGCTTGTCAGACATTAGAGTTCTTGAATAAATAATTAGAAGAGAAATGCTAAGTAAATAT
CTAATTATAAGAAACATACAAGCAAGAGTTTAATTAAAGAGAAAAGTTTGAAAATGAATT
GAAATACCTTTACCATAATGAAAAGAGTTAGCTTAACGTAGCTCTTAAACAAAATGAAAT
TTTTGAAAAATAGATTTAGGAAATTGAGCAAGAAATCACCTAAAAGATGGATAAAATTAC
TGATTTAGAGCATGATATTTTGGGTCTTTAGGAAAAGCTTAAAAATAATGAAAAGCGCCT
GAACAGTTTAGAAGTCGAAAAAGAATATTACCGCAATGAAACAGAATAATAGATTCAGTA
GATTTAAATTAAAGATGATAAAATTAAAGAAATAAATCAAGCCTTAGAAACTGCTTTATA
AATGGGTGAATAACTAGAAATGGGTGTCTAAGAATATGAAAAATAAAATAAAATTCTAAG
CGAATAATTGCTTTAGAAAGAGTAAGAAATATTAGAAAAAATTTTATAATTGGAAGATGC
AGAATAGAAGATAAGAGTATCTCAAATGACTCACGAATTGCTTACTTAAAAGATTTCAGA
ATTAGAGAGTTAGTTAGGAGAACAAATTACTTTGAATACAGGCTTTTAAGATTAAATTGT
GTTATTATCAGAAGAAAAGAAGGACCTAATTTAAAAAGAAGCTTAGTTGATTGAATCTAA
TTTAGAATAAGAAAAAACCATAATTGAGTTGAAGGAAAATTTACAATAATTGGAGTAATT
GTGCAAGGAAAAAGAAACATAAATAGAGTAAATTAAATCTGATTTCTATGAACTAAAGAA
GTCTTCAGAGGATTACTAGTAGATTTAAGATCATGAGCTAAAATCTGTCAAAGAGCAGAA
TAACAAACTTAATGAATAAGTGTAAAACTATGAATTTGAGGTATAAAACATGTAATAGAA
GGCTTCTCAAATGGAAGAAGACATGGAAGTCTTAAAGTAAGAAATATAAGAAAAGCAAGA
GCTCTACCTTCAAAGTGAAAAATCAAAGGAGGAACAGATCTCATAAAAAAATCAAAAGAT
AGAAGAACTCATTTAAGAAAGATAAGTCTATGAAGAAGAATTCGATAAAATTTAAACTAA
ATATTCAAACCAAATGCGTAATATATCTGAACTTCAACAATCATTTTAAGCAGCCAGAAC
TGAAAATGAATCTATTAAAAAACAAATCGAAGATAATAGAGTATTTATTTATTTATAATA
AATTTAATAAAATGAAAATTTAATGATACATTTTTGTAATAAAAAGGGATAAATGGAGAT
CTTCTAATTAGAGAAATAAAAGTTTGAAATAGAGAAACAAAAGCTTGAAACTGAAAGACA
AACTATCTAATAAGAAATGTATTAGAAAGATATCCTCATTTAAAAATTCAAAGAAGAATA
AGAACAAATAGGATGCAAGTTTGAAATATTCAAGACCTTACACGAGTAAATAGAAGAATA
AAAGAATGTTTATCAGTCTAAATATGTCAATAAAAGTAAAGAGCTTGATAATTACGAATA
AAAATACAATACCCTTGAATAAGCTATGGAAAGACTTAATGTAATATTTTAGATTTTATT
AAAATTCTTTAAAAATATTTTATTAAATAGGAAAAACTTACTATAAAATAATTGGAAAAT
AACAAACTAACTAACTAGATTCTTATTATGCAATCCAATAGAGAGAAAAACTAATTTACA
TAAGAAGAGTAATTTATTAATTTTAAAAAACATAGTTTTAAATTTGTTTTTATATAGCTT
GTAAAGAGATTTGAAAAAATCAAGAGAAGAATGCTCTCAGATCAAACAAAAATACAAGGC
TCTTATATTGGAAAGATAAGTCTAATCACAATAAGCTAACAGATTTAATGGAAATGCTAA
TGATCAAAACATCATAATTAAAAAATTAGAGGAAGAGAACAATAAAATTAAGGATTAATT
TAATAAATACAAGCAAATATCAGAAAAAAAGATAAATGAAATATGTGAAAAGCTTAATAG
AGGAATATCCACTGCAACCATAGTCAAAGATATTTCTAACTCGACTGAGATAGCCAAGAA
ATTAGAAGTAATCTATTTTTTTTAAAATAAATAAAGATCTTAATTGTTTAATTAACTTCT
TTTATATTTTAAAAAATATTTTATTATATTTAATAGAAATAATGTGAAATTATAAATGAA
AAAAACATGGGAATATTAGAGATAAATATTCTAGTAAGAAACTATCTTATAGATTGCAAG
AAGGGATAAATTGATCCTACTTAAAAAGACGAATATCTTGAAAAAATTTAATCTTAAGAA
GATACTACTGCTCTAAAAGAGGTTCTTTCAAGTGTTTTGAAGAGTGTTGAGGTAAAAAAA
TTTGTTTTCTAATTTATATTAAAAATAATTCATTTATAGGAAAGAGAAAGAAAGGTATAA
CAAGAAATGTATTAGTTAAAAGAAAAGAAGGCCTCATATGAATATTATAGATCTAAGTGT
GAGGAACTTGAATTCAGATACGAGAAGAAGAATTCTGAAACGGGTGAGAAAATTCTTAAC
AGAAAAAGAAAATTGAGCGTAAAAGAAAATGAGGTACCAATTTTAGGTGAGATAGATTTA
AATAAAAAAGTAAAAGCAAATTTTTGA


>TTHERM_00125500(protein)
MIKTDQENIQVLVRIRPLNSREKAEGATPCMQVDKSNPTTVIIDGKSYNYDYITGSETTQ
EDIFHIVGKPVALAWLEGYNACIFAYGQTGAGKTFTMQGKGLIEEGAESPNRGLQPRVFD
YVFGLINSLKKENPENEYLITCNYLEIYNEQIMDLLAEQKHDANAKPVQLSVREDLKKGV
YVENLCEEVANSSEDAINLLIKGASARHVGATKMNADSSRSHSVFSLNFQSKIVSNGMIH
VKNSKLHFVDLAGSERQKSTGAAGDRLKEASNINKSLTVLGLVINALVESANGKSRHIPY
RDSKLTFILKDSLGGNSRTFMIAACSEANTQFQETLSTLKFAQRAKMIKNKASVNEESQG
NVQQLKKEIQKLKEELQDAKKALQEMEENQKNMTRIITPAKYTPTSMNHEAVIQFQQKNF
KEINIKLEEVNQLLSDFNDSRSRIEEFFKNEKLGVLRVFQDIVDQKKMGQDVDIIKALTQ
KSDMEEEGISSLLTEIDQTIVEDIQQMTQTCIKLEEFEERRKDFTSKLEKIGLMNFGCPE
KEKELEEAIIQREKRIIELQNEQAHQNKLFNQQLEEISNQRDHFKEVNQGLNSEIQSLQQ
QIAKNVQTHEEKIQQFKNGFESKLAEYDQNSSEIKIKNMELADEIDELKSHIENLNRIKD
DIKQKWENAYENYQKTLQTKNEIENQKDSIQSQLNISREENTNLMFKLSEAENLYNQDRL
HMMTLEDELNSQKNIIQEKDHQINNLVSRIEEENLRLQATIDKQKDDIASLEDQITKSKE
DIEIACQTLEFLNKQLEEKCQVNIQLQETYKQEFNQREKFENELKYLYHNEKSQLNVALK
QNEIFEKQIQEIEQEITQKMDKITDLEHDILGLQEKLKNNEKRLNSLEVEKEYYRNETEQ
QIQQIQIKDDKIKEINQALETALQMGEQLEMGVQEYEKQNKILSEQLLQKEQEILEKILQ
LEDAEQKIRVSQMTHELLTQKISELESQLGEQITLNTGFQDQIVLLSEEKKDLIQKEAQL
IESNLEQEKTIIELKENLQQLEQLCKEKETQIEQIKSDFYELKKSSEDYQQIQDHELKSV
KEQNNKLNEQVQNYEFEVQNMQQKASQMEEDMEVLKQEIQEKQELYLQSEKSKEEQISQK
NQKIEELIQERQVYEEEFDKIQTKYSNQMRNISELQQSFQAARTENESIKKQIEDNRGQM
EIFQLEKQKFEIEKQKLETERQTIQQEMYQKDILIQKFKEEQEQIGCKFEIFKTLHEQIE
EQKNVYQSKYVNKSKELDNYEQKYNTLEQAMERLNEKLTIKQLENNKLTNQILIMQSNRE
KNQFTQEDLQRDLKKSREECSQIKQKYKALILERQVQSQQANRFNGNANDQNIIIKKLEE
ENNKIKDQFNKYKQISEKKINEICEKLNRGISTATIVKDISNSTEIAKKLEKQCEIINEK
NMGILEINILVRNYLIDCKKGQIDPTQKDEYLEKIQSQEDTTALKEVLSSVLKSVEERER
KVQQEMYQLKEKKASYEYYRSKCEELEFRYEKKNSETGEKILNRKRKLSVKENEVPILGE
IDLNKKVKANF