Identifiers and Description

Gene Model Identifier

TTHERM_00126950

Standard Name

RAB13A (RAB GTPase 13A)

Aliases

PreTt09358 | 9.m00580 | 3699.m00088

Description

RAB13A Ras family small GTPase; Rab VIII family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00071 ) Ras family
  • ( PF01926 ) GTPase of unknown function
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09114.1 9.99668353155528e-144
Description: Ras family protein (210 aa)
Oxytricha Contig15751.0.0.g87 6.002203762674495e-72
Description: Ras family
DictyBase DDB_G0280043 9.995417076252815e-72
Description: rab8A on chromosome: 3 position 3266503 to 3267523
WormBase WBGene00004272 2.999277470785175e-69
Description: locus:rab-8 status:Confirmed UniProt:G5EFC1 protein_id:CCD68351.1
SGD YFL038C 1.9997677415930956e-65
Description: YPT1 Rab family GTPase, involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by protein geranylgeranyltransferase type II (Bet2p-Bet4p)
Stentor Coeruleus SteCoe_11143 7.281290178321643e-33
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00126950(coding)
ATGTAAAGACCAAAAGATACCGAATACGATTGGATATTTAAGTTACTTATTATTGGTGAT
TCTGGTGTAGGAAAAACTAATCTTTTATTAAGATTTTGCGATGATAAATTTGCTACCTCG
CATTTAGCAACTATGGGTATTGACTTTAAATCCAAAAAGATAGAAATTGATGGCAAAAAA
ATAAAATTACAAGTTTGGGATACTGCTGGCTAAGAAAGATTTAGATAAATCACATAAAAT
TATTATAAAGGAGCTATGGGCGTTATTATGACCTACTCAATAAATGATAAAGAATCCTTC
AGAAATATTGAAGTTTGGATGAAACAAATCAGATAATAAGCAAGTGTAAACATTGCAAAA
TTACTAGTAGGTAATAAATGCGATATGGAATCCGAAAGACAAGTAACATTTGAAGAAGGT
AAATCCCTCGCAGACACATTCGGAATTAAATTTTTCGAAACCTCTGCAAAATCTGATATA
AATGTAACTGAGGCTTTCTTCACTATTTGTAAGGAAATTTAAGAAAAAATTAATATCAAC
CCAGAACCAAAGAGTGAATCTCCATTTACTCTAAAATAAGAATAGAACAATAATGGTAAA
AACACTGGAAGAACATGCTGTTGA


>TTHERM_00126950(gene)
ATGTAAAGACCAAAAGATACCGAATACGATTGGATATTTAAGTTACTTATTATTGGTGAT
TCTGGTGTAGGAAAAACTAATCTTTTATTAAGATTTTGCGATGATAAATTTGCTACCTCG
CATTTAGCAACTATGGGTAAAATTATTTAAGAAATTCACATTAGCAATTTGAAATAAAAA
ACGATTATTGCAAAAATTATTTAATACCCATTTTAAAATGTTTATTTGATGGCTTCATCT
AATTTATTTAATTTGAGCCAAAAGAATTTTGCGTATTTTGTTCAACTTTAACTAATGAAA
AAATAAATGATCGATCTCATAATTAATTTTAACTAAAAAGGTATTGACTTTAAATCCAAA
AAGATAGAAATTGATGGCAAAAAAATAAAATTACAAGTTTGGGATACTGCTGGCTAAGAA
AGATTTAGATAAATCACATAAAATTATTATAAAGGAGCTATGGGCGTTATTATGACCTAC
TCAATAAATGATAAAGAATCCTTCAGAAATATTGAAGTTTGGATGAAACAAATCAGATAA
TAAGCAAGTGTAAACATTGCAAAATTACTAGTAGGTAATAAATGCGATATGGAATCCGAA
AGACAAGTAACATTTGAAGAAGGTAAATCCCTCGCAGACACATTCGGAATTAAATTTTTC
GAAACCTCTGCAAAATCTGATATAAATGTAACTGAGGCTTTCTTCACTATTTGTAAGGAA
ATTTAAGAAAAAATTAATATCAACCCAGAACCAAAGAGTGAATCTCCATTTACTCTAAAA
TAAGAATAGAACAATAATGGTAAAAACACTGGAAGAACATGCTGTTGA


>TTHERM_00126950(protein)
MQRPKDTEYDWIFKLLIIGDSGVGKTNLLLRFCDDKFATSHLATMGIDFKSKKIEIDGKK
IKLQVWDTAGQERFRQITQNYYKGAMGVIMTYSINDKESFRNIEVWMKQIRQQASVNIAK
LLVGNKCDMESERQVTFEEGKSLADTFGIKFFETSAKSDINVTEAFFTICKEIQEKININ
PEPKSESPFTLKQEQNNNGKNTGRTCC