Identifiers and Description

Gene Model Identifier

TTHERM_00127080

Standard Name

ERI4 (ExoRIbonuclease 4)

Aliases

PreTt09371 | 9.m00392 | 3699.m00101

Description

ERI4 exonuclease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09125.1 9.997093137033517e-262
Description: exonuclease (564 aa)
Oxytricha Contig3963.0.g42 6.000802209040518e-34
Description: RNA 2-phosphotransferase, Tpt1 / KptA family
WormBase WBGene00019825 2.998577119979921e-31
Description: status:Confirmed UniProt:Q9TZZ9 protein_id:CCD73172.1
DictyBase DDB_G0283113 1.0000422327488734e-24
Description: eriA on chromosome: 4 position 263707 to 264369
Stentor Coeruleus SteCoe_23725 0.000000000013887943864964021
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127080(coding)
ATGCATCAACACATTCTTCCCATGTTCTTGATGCCTGACATGCCTATGTTCTGCGTCAGA
AATTGTGGCTGTCGTCATCCTGATCGTGCTCATTGCTTCTCATGCCACAAAACAAGTGAA
AAATATAAGATTAAGCACAAGGATGACATGTGCTGTGAAAGCGAAGTTTCTCTCGAATAC
CTTTTTGTAATCGATTTTGAATGCACTTGCGATGAAGAAAAGCGTCTTAAAATACAAGAA
ATCATTGAATTTCCTATTGTTGTTATCGACCTTCGTAAAAAGGAAATCATAGATCGTTTC
CATTCATTTGTTCGTCCTACTCAGTACCCTATTCTAACTCCTTTCTGCACTAAGCTTACT
GGAATCACACAAGAATAAGTTGACTCAGCTCCTACTCTCCCTGAAGTATTGAAAGAAGTC
GATCGCTTCTTGGAAAAGTACATCAAGGATGGATTACAAAAAGTTTCAGTCTTAAACGAC
TGCGACTCTGATATTCGTAATTTCCTTCGTAAAGAAACCACATTCAAAGGTATTCCAGTC
AAACCTGTTTTTAAAGAATTCATCGATCTTCGTCGTATATTTCCTGTTAAGATATCAGAA
AAACCTACAAACATCGACCACATGCTTTCTTGTGTGGGGTTAACCTTTGAAGGAGTGAAA
CATTGTGGTTTAGATGATGCAACAAATATTGCCAGAGTTGCTTTAGAAATTGCTAAAAGA
GATTACATCTACACTGAACATCTTAAGGAACACATGTATCCCTATGATAACCCTCACTAC
TATGAGCATTTGGTAATCATAGCAACCTAACCTAAAATGAAAAATAACGTAGAAATTGCT
ATGATAGCCCATGATTTAAGAAAGGGAAAGACTCTTTGGAATAATCTAGGAAATAAGAGT
GTCAAGAAATAAGAAATGAAAAAGGAGCTCTTCGAATTCTTAGATAAAGTTGGAATTGAC
ATCAATAACTCTATTTTGTGTGTTCAAGGTAAGCTTGAAAACGAAGTTCGTGCATTCTTC
CAAACTTCTGAAAATCAACCAATGAAGAATGAAGGTAACACTAACTTGTTTATGAGTGGA
AACTTAACAGATAGTACATCTTCTACTTGTTCTTCTTCTTCATCATCACCTTCTTAATAA
TGTTAAAGCACTTCTACAAATTGCCTCACAAGCTCTAACATCTCCTCCATAAACAACTCT
GCATCTTCTAACTAGCAACAGCCCCAATCACCATACTAATCATCTTCATTTAACAATTTC
TTTACTACCTACTTCTCCCTTAACAAAATAAGCAAAATTGCAGGCATACCACTCGCTGGA
AATTAATTCATTTAACACCCTACCTACTCATAAAGATACTAGCGCAACAGAAATGTGTAC
TAGCCTTACCCATTCTAAATGAATGGATAATACTATCCAATTGACTAGTCATTCATGAGT
GGATGCAATAATCCATTTTAAACTTAATTTGCAAAAAACTAATAAAATTTTGCAGATTTA
AATTAAGCAAACAATGAAAACTTGACTAAATGGTGGAATGGTATTAAAGATACTACCTCC
CCTGTTACTAGAATTACTACCATGTGTAACACAGTAGAGACAGCTCTTCAAAATGGTTTT
ATCTTCACCAAGGACTTCGCCTCCACAATCCAATTCAAGAGAGCCTTATCTAAAATGTGA


>TTHERM_00127080(gene)
ATGCATCAACACATTCTTCCCATGTTCTTGATGCCTGACATGCCTATGTTCTGCGTCAGA
AATTGTGGCTGTCGTCATCCTGATCGTGCTCATTGCTTCTCATGCCACAAAACAAGTGAA
AAATATAAGATTAAGCACAAGGATGACATGTGCTGTGAAAGCGAAGTTTCTCTCGAATAC
CTTTTTGTAATCGATTTTGAATGCACTTGCGATGAAGAAAAGCGTCTTAAAATACAAGAA
ATCATTGAATTTCCTATTGTTGTTATCGACCTTCGTAAAAAGGAAATCATAGATCGTTTC
CATTCATTTGTTCGTCCTACTCAGTACCCTATTCTAACTCCTTTCTGCACTAAGCTTACT
GGAATCACACAAGAATAAGTTGACTCAGCTCCTACTCTCCCTGAAGTATTGAAAGAAGTC
GATCGCTTCTTGGAAAAGTACATCAAGGATGGATTACAAAAAGTTTCAGTCTTAAACGAC
TGCGACTCTGATATTCGTAATTTCCTTCGTAAAGAAACCACATTCAAAGGTATTCCAGTC
AAACCTGTTTTTAAAGAATTCATCGATCTTCGTCGTATATTTCCTGTTAAGATATCAGAA
AAACCTACAAACATCGACCACATGCTTTCTTGTGTGGGGTTAACCTTTGAAGGAGTGAAA
CATTGTGGTTTAGATGATGCAACAAATATTGCCAGAGTTGCTTTAGAAATTGCTAAAAGA
GATTACATCTACACTGAACATCTTAAGGAACACATGTATCCCTATGATAACCCTCACTAC
TATGAGCATTTGGTAATCATAGCAACCTAACCTAAAATGAAAAATAACGTAGAAATTGCT
ATGATAGCCCATGATTTAAGAAAGGGAAAGACTCTTTGGAATAATCTAGGAAATAAGAGT
GTCAAGAAATAAGAAATGAAAAAGGAGCTCTTCGAATTCTTAGATAAAGTTGGAATTGAC
ATCAATAACTCTATTTTGTGTGTTCAAGGTAAGCTTGAAAACGAAGTTCGTGCATTCTTC
CAAACTTCTGAAAATCAACCAATGAAGAATGAAGGTAACACTAACTTGTTTATGAGTGGA
AACTTAACAGATAGTACATCTTCTACTTGTTCTTCTTCTTCATCATCACCTTCTTAATAA
TGTTAAAGCACTTCTACAAATTGCCTCACAAGCTCTAACATCTCCTCCATAAACAACTCT
GCATCTTCTAACTAGCAACAGCCCCAATCACCATACTAATCATCTTCATTTAACAATTTC
TTTACTACCTACTTCTCCCTTAACAAAATAAGCAAAATTGCAGGCATACCACTCGCTGGA
AATTAATTCATTTAACACCCTACCTACTCATAAAGATACTAGCGCAACAGAAATGTGTAC
TAGCCTTACCCATTCTAAATGAATGGATAATACTATCCAATTGACTAGTCATTCATGAGT
GGATGCAATAATCCATTTTAAACTTAATTTGCAAAAAACTAATAAAATTTTGCAGATTTA
AATTAAGCAAACAATGAAAACTTGACTAAATGGTGGAATGGTATTAAAGATACTACCTCC
CCTGTTACTAGAATTACTACCATGTGTAACACAGTAGAGACAGCTCTTCAAAATGGTTTT
ATCTTCACCAAGGACTTCGCCTCCACAATCCAATTCAAGAGAGCCTTATCTAAAATGTGA


>TTHERM_00127080(protein)
MHQHILPMFLMPDMPMFCVRNCGCRHPDRAHCFSCHKTSEKYKIKHKDDMCCESEVSLEY
LFVIDFECTCDEEKRLKIQEIIEFPIVVIDLRKKEIIDRFHSFVRPTQYPILTPFCTKLT
GITQEQVDSAPTLPEVLKEVDRFLEKYIKDGLQKVSVLNDCDSDIRNFLRKETTFKGIPV
KPVFKEFIDLRRIFPVKISEKPTNIDHMLSCVGLTFEGVKHCGLDDATNIARVALEIAKR
DYIYTEHLKEHMYPYDNPHYYEHLVIIATQPKMKNNVEIAMIAHDLRKGKTLWNNLGNKS
VKKQEMKKELFEFLDKVGIDINNSILCVQGKLENEVRAFFQTSENQPMKNEGNTNLFMSG
NLTDSTSSTCSSSSSSPSQQCQSTSTNCLTSSNISSINNSASSNQQQPQSPYQSSSFNNF
FTTYFSLNKISKIAGIPLAGNQFIQHPTYSQRYQRNRNVYQPYPFQMNGQYYPIDQSFMS
GCNNPFQTQFAKNQQNFADLNQANNENLTKWWNGIKDTTSPVTRITTMCNTVETALQNGF
IFTKDFASTIQFKRALSKM