Identifiers and Description

Gene Model Identifier

TTHERM_00127130

Standard Name

ALG8 (Asparagine-Linked Glycosylation 8)

Aliases

PreTt09376 | 9.m00397 | 3699.m00106

Description

hypothetical protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09130.2 1.9999590304423412e-72
Description: hypothetical protein (1080 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127130(coding)
ATGGATGAATAAAATTTTCATTAGAAAGATAACAAAGAGAATAATCATAGTACTGACTTT
GAAGTTCATCGAAACTGGCTCCGTATTACCTATAACTTGCCTTTAAGAGAGTGGTATTAT
GATGATGTATCGATATGGACTCTTGACTACCCTCCTCTGTTTGCATATTTTGAATACATT
TTGACATTTCCTGCTCGTTTCTTTGATATGAAGATGCTAGAAACCAATCAAGAATATAAA
AGTGAAAATACTGTAATATATTAAAGAGCGACTGTGATGATTAGCGATCTTCTATTTTTA
TATGCAATCTGTAACTTCATAAAAGTCAGCTTTGGTAAAAATAAGTAAAATTATGCTTAT
GCAGTCCTGTTCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTGATAATATCCATTTCCAA
TACAATTAATTCTTATAGGGTATTTTTATACTTTCCTTAACTAAATTTATCGAGGGAAGA
AACATATTCGGAGGAATTCTCTTTGCATTGGTTCTTTGTTTCAAACACATATTTCTCTAT
TCTGCACCTGCGATATTTTTCTTCTTACTAAAGTTTTATTGCTTTGATAATGGCAATAAA
TTAAACATTAGAAATTTCTCTAAGTTAGGGATGAGCGTCGTTACAGTATTCTTGATTTCG
TTTCTCCCCTTTTTAAGCTTGGATGCAATCAAGTAAATTTTAAGCAGAATGTTTCCCTTC
TAGAGAGGACTAGTTCATGCTTACTGGGCACCTAATTTTTGGGCTCTTTATTGCTTCGCT
GATAAGGTGCTTTCAACATTAGCAAGAAAATTGCTTAAAATACCCATAAGTTCTAAGAGT
ACTTTGACAAGTGGCGTCGTTCAAGTGACTTAATTTGATATTCTACCAGAGATAAAGCCA
ATATACACAATAATGGCTATAATTATTATATCATTACCTCTTTGGTATAAGATAGTCAGA
AACCCAAAAGCATAAAACATCTTGCTTTATAGCAGCATCTAAATGTTTATATTTTACATG
CTAGGCTATCATGTCCATGAGAAAGCAATATTACTCCCTCTAGGAATCTATCAGTTATGG
GCGATAGGAAAATAAAGTAGAAGCAGATTTGTATTGCTTTTCTCATTCGTAAGCGGCGTA
GGCTTACTTCCACTACTTCCAGAGCATTCTGAAACTGGACTTAAAATCATTGGACTATTC
ATTTATCATCTAGCATATTGGGCTTACCTAAGAAGAGATTGCTACAGAGAAGCTCAGAAT
TTAGATGATTACAAAAAATTTGGAATGAATTTTTTTGCAAAGTTTATTATATTCTCTGGG
ACAATAATTGCAATCTATGGAAATGTTCTTCATTACATTCTTTTTTTGAAATCAGAAAAC
AAGTTTGAATACCTACCTCTTATGATCCATTCAGTTTATGGAGGTATTTTGAATTTGTAC
TTCATCATTGAAATGTACTTAGAACTATTTAGGTCTCAAAATTAAATTTCAATATAAGAA
GTAAAATAATGA


>TTHERM_00127130(gene)
ATGGATGAATAAAATTTTCATTAGAAAGATAACAAAGAGAATAAGTTAGCTTACAAGCAA
TTAAGAATATATTGATATTTAAATAAAATTAGTTTTCAAACATTCTCAAACATATTTTAG
AAACTTTTTTATTGTGTTTTATTTAAATATTGCTTAAGAGGACAACTCATTTTGATTATT
TTTTTATCCATTCTAATTTTATTGATTCATTTATTTATTCATTGATTTATTTATTTTTTT
ATTGATTTATTGATTCATTTATTTATTAGTTATTCTTTTTTAATTGAAAATCATTCAATA
TTACTTGGGTTTGATAACATCTAAAGTACATAGTTTTTAATGTAGAGTTGGTCAAGCTTA
CTTGCTTTCTTTTTGCAAGCAGTTATGCCAAGCTGGAAGAGACAATACCTTTGGAGGTAC
ATACGATTCGTTTTATTAAAATAATTAATTTTACCAATGTATTGGTTGATTTCTTAAATT
TTTATTGGATTATCGAGCAAGTACTAACTCAAATAAGTAGAATTTTACTCAAATATTTGA
CTATTTTCTTCAGGGAAAATTTATTTGAATTATTCTAAGTTTGTAAAGCTTTTAATGATG
GTGATGATGTAAGTTATTTTACGTTACTTTATCAGCTTTAGCTTTGAATCAAGCTCTTTC
ATATTCTCATCTATTTCATCAAAGCTTATTTCATCAATTTCTTTCAAAAAGTGAGAAAGA
TCACTTTTCGTAAACCTATTCTTGAAAGCATCTAGATACCTAATGTGCTACTCATTAATT
ACCCTATTAGCTTCGTTATCAACGATTTTAATTTACAATGAAATCTACTCTTTTATATAT
TTGCTTGACTAAAGCATAAAAATTTTAAGCTAGTTATGAAATTGCAATTTCTTTTAAAGT
TCTGATTCAGATAATTTCTAGAAACTTGCTATTTGAATATCTTTTTCTTAACCTTTTCTG
AATCTAATCAAATCTTTCGTATCTGAATATTTTTTCGGCTTTTTCTCTATCTGTTTTTTA
AGTTTACTGAGATGTCCATGAGTTTCTTTAAACTTTTATGTTTTATTATAAGCATCAATG
ATTCTTTGGAGTTAGGTTTGTTTACCACTGGTTTGCTAATCTAAATTGTAATCATTATTT
GCTTATTCTATCTTGATTTGATTCTCTACAACCTAAAAGCTTTACTATGATATATCTAAA
ATTCTAGATTCGTTTTTATTATATGCAGTATTTGAATTGTTTTGGTTTTCCTCAATCATG
CTACTAACTTGTTTTGAACCAAAACCTTCTCCTCTATTACCTATTAGATTTAAACATGCA
GCATTATGCTCTTCTTTGATAACAATTTGCAAAGGATCTAAATTCTAATTTAATTATTGC
TAACCCTAAAGTAGAGACTCGTGATTTCGAATCTATTATGACTAATAGTTAGAATATAAA
TATTCTTTTGTTTCAAACTAATAAGGGGGAGGAGGTGGATGAATCTAATTTTATTTTTGA
CAAATAATAGATAAAGCTGAATGGGGAAAAGCTTAACAAGGATTAATAATTTTTTCAAGA
TAATTCTATTGTAATTTATTTTCAAACTATTAGCAATAATTAATTTTTCTTTACAATGCA
TTTTCATATTAAGCTTGATTAAACTAATACTAATGGTTGTTCAGGATAATTGGATGGTCA
GCATTCTCGCTTTCTTTTTTTATTAATATTCCATTTTATTATAATTCATGATTGCTTTGA
CTTTCTCCAATTTAATTAATAATTTCTGTACTTTTTAACTAATTATCGTCAAAGTTTTGA
TTTTATTATTTATCGCTTAATTTTACAAATTAACTAGAATTCTAATCAGAATTAGTTTAA
CCATTTTCAGCTAATGAAATGGCTATGTTCTTGTCCTATTTCTCTGATGCATCATATTCT
AACTTGATATTATCATCCTAAAGGGGCTTAATTAAACTGGCTTAAGAACTTAACTAAAGT
TAGGTACTATGGTCTGCAGAATTTGTTTTGTTTTCTCCTTATTTATTTGCTTTATATGTT
GCTGACTTCTATTTTTGCTATTATATTTTTTTTTAAATATCCTCTTATTCTTCCAGATTG
ACAAATAGCTAAGATTAGATTTCACGTTTTCTTTGCTCGAGGTCTAAACAATCTTATATG
GCTTGCAATAGCTATTGACAAAATTCTTTCTAATCTTACAAATTGTTACTTTCTTTCTAG
ATAAGCCTAACAAGTTCTTATCTGATTTTTTACTTCATTTCAAGTAATACTTTTTTTTGT
TATAATGTATTTTTTAGATTTTCAAATTCCTGATTAGTCAAAATTAATTTCTATTCAAGG
TTATCATCCTCTTCGGGCTCATGACCTGGGTGAATTAAATTTTTTTATTAATTCATTTAA
GCATGGAGCATGTAATTTTAATTATATCTATCATTCGATGTATCAACTCCTATTCTTTCA
TATTAGTTATTATATCTATTGAAATATTGTCTTTATACAAAATTCTCTCTATTACCACTA
AAGCAATTCTAATTTAATTAATTTGGATTTTAGATATTTTAATTAATATTTTTGGAAATT
TATCCTTTATATTCTAATTATTGTGGGGTGTAATTATAATTTGATATATCATTTGATATT
TTCATAGTCTTTAAATTTTAATTTGGTAAAAAAATCATCTAAGCATTTACTTCGCTTTTA
TCTTCGCTTAGCTCGGGAATAATTTATTATTGATCAAGCTGAAATTGCTATAGAGGTGGT
TAAAATTAATACCTAGAATACCTATTATTAATTTCCTCTGGCTTGAGATGTTCTTCAGGT
TAATGATTTTCATAGATTTTATTATATTACTATTTATTTGGTATAATTTTGTTATGGTAG
CCCAGTATTCTAGAAGGATTAATTGAAGATTAATTATAATAATTAGGGTTAAGAATAGAG
GAATTTTAAATTTTTTATTAAGAAATTTTATGATTCTATATATCAGGTATAGCTGTATTA
ATCTTTTAGATGTCAAATTCTTTTTTTGACAAAGGCACTGCTAATTCTATTTATTTGTCA
TATTAAAAATGACCTTATGTAATAGACTAATCATTTGCCTGTAAATAGCTTTCCTAAACC
ATCTTTTCTTGATTTACCTCCAAATTCTTTCCATAATGAGCTTTAGTAGAAAGTTCCTCT
TAAATTTCTATAGAATTTTTTAAATAATTCTCTTTAATGGTGTCAATCATTTTTTACTTC
AATCGATCAATCGAACTATGCGTCTCTTAATTCAATCTAATTTTAATCTTTAATATTATT
TTAATTCAAAATAAATCCAATATTTTGTGATTAGTAACTTCAATATGCTAGATTTTTGCC
CAATAATTTTTTGATAAGATGCTAATGTGAAAGATCGATCTATTCTTTTTTTTCACCTAT
TTTTTTTAAGTTTTTTCTTAATAAAAAGAATTCTTTATCAAATTTTTATTTAGTAGAAAA
AAGGTAAAGTCTTGGAAAAAAAAATCGATGTTTGATTTAGTTGCTATTTGCTTTTTAATA
AAGCTCTTGTTGGTATTTGCTTAGTAAAAATTTGACCTTTAGATTTTTTTAAACAAACAA
TTAAACCCTCAACATAAATTTAACGCTTATCGAGATTCATAAACCCTATTTATAGATAAA
CTCCAACGCATAAAAACTACTCTAAATTAACTTCATTTTTAATTATAGTCATAGTACTGA
CTTTGAAGTTCATCGAAACTGGCTCCGTATTACCTATAACTTGCCTTTAAGAGAGTGGTA
TTATGATGTAATTAGATTAATTTCAAAATTATGCAACAAATCGATTATTTTCTACAAAAT
AACATAAAAATTAAAAGGATGTATCGATATGGACTCTTGACTACCCTCCTCTGTTTGCAT
ATTTTGAATACATTTTGACATTTCCTGCTCGTTTCTTTGATATGAAGATGCTAGAAGTAC
TTAGAAGTTTAATATCTTTTCTATGTATTTGATTAATATCTTAATTTAATACTGAATAGA
CCAATCAAGAATATAAAAGTGAAAATACTGTAATATATTAAAGAGCGACTGTGATGATTA
GCGATCTTCTATTTTTATATGCAATCTGTAACTTCATAAAAGTCAGCTTTGGTAAAAATA
AGTAAAATTATGCTTATGCAGTCCTGTTCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTG
ATAATATCCATTTCCAATACAATTAATTCTTATAGGGTATTTTTATACTTTCCTTAACTA
AATTTATCGAGGTAAATTAACTAAAAATAATTACTAACTGTATTACTCAATTTGAAGACA
TTTATTCCGCTCTTAATACATAAGCTAATTCAAAACGAATGAAAAGTACATTAAGGGGCT
TTATAAAATTTAATCTTATTAGTGTTAGGCTTAATTTACTTTATTATTATTAAAATTCAA
AAATAACACTTATACTCAATTTATTTAAGCTAATTTCATCAAAAATAAAGGGAAGAAACA
TATTCGGAGGAATTCTCTTTGCATTGGTTCTTTGTTTCAAACACATATTTCTCTATTCTG
TAACAAAAAGAAACGAAAAGTTAATTAAAAAATTGAATAAAACTTAATTAAAATTAGGCA
CCTGCGATATTTTTCTTCTTACTAAAGTTTTATTGCTTTGATAATGGCAATAAATTAAAC
ATTAGAAATTTCTCTAAGTTAGGGATGAGCGTCGTTACAGTATTCTTGATTTCGTTTCTC
CCCTTTTTAAGCTTGGGTAAAAATTAAATTTCATAATTAGCTACTAGCAAAATATATATT
TATTTTTATAAATTAGATCCTAATTCTTTAAATAAATTTTAAAAAGAGAATTAGTTGCTA
CTTTAATTAATTTTTTGTCAATTATAAATTGTTTAGATGCAATCAAGTAAATTTTAAGCA
GAATGTTTCCCTTCTAGAGAGGACTAGTTCATGCTTACTGGGCACCTAATTTTTGGGCTC
TTTATTGCTTCGCTGATAAGGTGCTTTCAACATTAGGTGAGATATTATAAATTAAGCTAT
TTTGTAATAAAATAACATTCTTTAAAAGCAAGAAAATTGCTTAAAATACCCATAAGTTCT
AAGAGTACTTTGACAAGTGGCGTCGTTCAAGTGACTTAATTTGATATTCTACCAGAGATA
AAGCCAATATACACAATAATGGCTATAATTATTATATCATTAGTAAAGATATTTTTTTAA
TCATTAACATCAATAAATAAAAGAATATTTTAATTTATTATACTCAAGCCTCTTTGGTAT
AAGATAGTCAGAAACCCAAAAGCATAAAACATCTTGCTTTATAGCAGCATCTAAATGTTT
ATATTTTACATGCTAGGCTATCATGTCCATGAGAAAGCAATATTACTCCCTCTAGGAATC
TATCAGTTATGGGCGATAGGAAAATAAAGTAGAAGCAGGTCAATAATTTCTATTTAATTT
CAAATTATCATATAAAGTTATCAACATTCCTTCCTTCTTTCCTTTACAGTTAAAAATTGA
AGTTAAAATTAAAGCTTTTGAAAAAAAGAAAATAATTTCTTTAGAAAATTTTATCATTTA
ATTGTTTTATAAAATAATTAAGTTAATTAAAATAATTTATTATTATTTATAAAAAATAAA
ATATTTATTTATCTTAATTAAAATTAATAGATTTGTATTGCTTTTCTCATTCGTAAGCGG
CGTAGGCTTACTTCCACTACTTCCAGAGCATTCTGGTAAGAAAATAATTTTAAATATTTT
TTTTTAATATTTCCTTTGTAATAAAAATAAATAATTTTGATTATTTAATAATGCAAATAT
ATTAAAAATTAAGAAACTGGACTTAAAATCATTGGACTATTCATTTATCATCTAGCATAT
TGGGCTTACCTAAGAAGAGATTGCTACAGAGAAGCTCAGAATTTAGATGATTACAAAAAA
TTTGGAATGAATTTTTTTGCAAAGTTTATTATATTCTCTGGGACAATAATTGCAATCTAT
GGAAATGTTCTTCATTACATTCTTTTTTTGAAATCAGAGTAACCATTTGTTTTTAGAATA
GAACTAATATTAATTCTAAATTAAATTTATAAACAGAAACAAGTTTGAATACCTACCTCT
TATGATCCATTCAGTATCTTAAATAATTTCTCTAAAATTATTTTATCCTTATCATTATTT
AATAAATAAAAAAAGGTTTATGGAGGTATTTTGAATTTGTACTTCATCATTGAAATGTAC
TTAGAACTATTTAGGTCTCAAAATTAAATTTCAATATAAGAAGTAAAATAATGA


>TTHERM_00127130(protein)
MDEQNFHQKDNKENNHSTDFEVHRNWLRITYNLPLREWYYDDVSIWTLDYPPLFAYFEYI
LTFPARFFDMKMLETNQEYKSENTVIYQRATVMISDLLFLYAICNFIKVSFGKNKQNYAY
AVLFTFLQFGFLLVDNIHFQYNQFLQGIFILSLTKFIEGRNIFGGILFALVLCFKHIFLY
SAPAIFFFLLKFYCFDNGNKLNIRNFSKLGMSVVTVFLISFLPFLSLDAIKQILSRMFPF
QRGLVHAYWAPNFWALYCFADKVLSTLARKLLKIPISSKSTLTSGVVQVTQFDILPEIKP
IYTIMAIIIISLPLWYKIVRNPKAQNILLYSSIQMFIFYMLGYHVHEKAILLPLGIYQLW
AIGKQSRSRFVLLFSFVSGVGLLPLLPEHSETGLKIIGLFIYHLAYWAYLRRDCYREAQN
LDDYKKFGMNFFAKFIIFSGTIIAIYGNVLHYILFLKSENKFEYLPLMIHSVYGGILNLY
FIIEMYLELFRSQNQISIQEVKQ