Identifiers and Description

Gene Model Identifier

TTHERM_00128770

Standard Name

PPI19 (peptidylprolyl isomerase 19)

Aliases

PreTt09441 | 9.m00462 | 3699.m00170

Description

PPI19 peptidyl-prolyl cis-trans isomerase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00254 ) peptidyl-prolyl cis-trans isomerase, FKBP-type
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09190.1 3.998345761652816e-169
Description: TPR Domain containing protein (275 aa)
DictyBase DDB_G0285827 0.000000000000020000882446601127
Description: DDB_G0285827 on chromosome: 4 position 3706474 to 3707930
Oxytricha Contig19730.0.g30 0.0000000000005000841553255702
Description: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Stentor Coeruleus SteCoe_5770 0.00000000003775134544279098
Description: None
WormBase WBGene00016966 0.00000000006996681903814525
Description: status:Confirmed UniProt:Q18888 protein_id:CCD68181.1
SGD YGR123C 0.00000000009998509410508463
Description: PPT1 Protein serine/threonine phosphatase with similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth; computational analyses suggest roles in phosphate metabolism and rRNA processing

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00128770(coding)
ATGACTGCTTTTACTAACGTTGATGAAAAAGGTTTACTTTAAAAGTAGATTATTAAGGAT
GGAATTGGAGATTGCCCAGAAAAATACAGAGAAGTTTATGTTTATTTTGTTCTCAGAAAT
GAAAGAGGTGATTTAATCACTGGTACAGAATCACAACCCTACAAAGTAGTCATGGGACGT
GGAGATTCATTCTAGTTTATGGAATAACTTCTTTTGACTATGAAATTAGGAGAAAGAATT
TTAGCAAAAATTGATAAATAGCTAGTAAAGGATGATAAAAAGTTATCTAAATTAGTGAAC
AATGAAGAAATGAATTTAGAATTAGAAATAGAAATCGTAAGATTAATGAACTACAGAAAC
AGTTTATGGGAATTGGAAAGCGATGACAGAGAAGCCTTAGTTCAAACAATTAAAAACTAA
GGAAATGAATTTATCAAAAACAAAGAATATTAAAATGCTACATACAAGTATGAGTCAGGA
TTAAAAACAATAAAAAATGATTAAAATTCTGTTTTCGATGAAGTCTAATAGTCTTTACTA
AATAACTTATCTTTAGCATATCTTAAAAATAATCAATTTGCTGAATGTATTGAAACTGCC
ACTGAAGCCCTTAAAAGCTAGCCCTCAAATGTTAAACTTTTATACAGAAGAGCATAAGCC
TATTCTGGCACTCAAGAATACGAAAAAGCTAAGTCAGATTTGAAAGAAGGTTTGAAGCTT
GATCCTAATAATGCTGAGTTGCAAAAAGAATTAAACGCTTTAATTAACAAGGAAAAGATT
TAAATTGAAAAAGAAAAAAAAGTCTATGCTAACATGTTTAAATGA


>TTHERM_00128770(gene)
ATGACTGCTTTTACTAACGTTGATGAAAAAGGTTTACTTTAAAAGTAGATTATTAAGGAT
GGAATTGGAGATTGCCCAGAAAAATACAGAGAAGTTTATGGTAAATAAATTTAATTTATA
AATACTTAATTCTAAAATATTTTTTTATTTTGAAGTTTATTTTGTTCTCAGAAATGAAAG
AGGTGATTTAATCACTGGTACAGAATCACAACCCTACAAAGTAGTCATGGGACGTGGAGA
TTCATTCTAGTTTATGGAATAACTTCTTTTGACTATGAAATTAGGAGAAAGAATTTTAGC
AAAAATTGATAAATAGCTAGTAAAGGATGATAAAAAGTTATCTAAATTAGTGAACAATGA
AGAAATGAATTTAGAATTAGAAATAGAAATCGTAAGATTAATGAACTACAGAAACAGTTT
ATGGGAATTGGAAAGCGATGACAGAGAAGCCTTAGTTCAAACAATTAAAAACTAAGGAAA
TGAATTTATCAAAAACAAAGAATATTAAAATGCTACATACAAGTATGAGTCAGGATTAAA
AACAATAAAAAATGATTAAAATTCTGTTTTCGATGAAGTCTAATAGTCTTTACTAAATAA
CTTATCTTTAGCATATCTTAAAAATAATCAATTTGCTGAATGTATTGAAACTGCCACTGA
AGCCCTTAAAAGCTAGCCCTCAAATGTTAAACTTTTATACAGAAGAGCATAAGCCTATTC
TGGCACTCAAGAATACGAAAAAGCTAAGTCAGATTTGAAAGAAGGTTTGAAGCTTGATCC
TAATAATGCTGAGTTGCAAAAAGAATTAAACGCTTTAATTAACAAGGAAAAGATTTAAAT
TGAAAAAGAAAAAAAAGTCTATGCTAACATGTTTAAATGA


>TTHERM_00128770(protein)
MTAFTNVDEKGLLQKQIIKDGIGDCPEKYREVYVYFVLRNERGDLITGTESQPYKVVMGR
GDSFQFMEQLLLTMKLGERILAKIDKQLVKDDKKLSKLVNNEEMNLELEIEIVRLMNYRN
SLWELESDDREALVQTIKNQGNEFIKNKEYQNATYKYESGLKTIKNDQNSVFDEVQQSLL
NNLSLAYLKNNQFAECIETATEALKSQPSNVKLLYRRAQAYSGTQEYEKAKSDLKEGLKL
DPNNAELQKELNALINKEKIQIEKEKKVYANMFK