Identifiers and Description

Gene Model Identifier

TTHERM_00131110

Standard Name

RPS18 (Ribosomal Protein of the Small subunit 18)

Aliases

PreTt24232 | 10.m00281 | 3698.m00005

Description

RPS18 40S ribosomal protein S18 putative; Homolog of yeast RPS18- human RPS18- bacterial RPS13

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00416 ) ribosomal protein S13p/S18e
  • ( PF00633 ) Helix-hairpin-helix motif

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05676.1 1.0003602942354155e-110
Description: ribosomal protein S13p/S18e containing protein (214 aa)
WormBase WBGene00004487 9.999353957415832e-59
Description: locus:rps-18 status:Confirmed UniProt:O18240 protein_id:CAB16517.1
SGD YML026C 1.0000099287337047e-53
Description: RPS18B Protein component of the small (40S) ribosomal subunit; nearly identical to Rps18Ap and has similarity to E. coli S13 and rat S18 ribosomal proteins
Oxytricha Contig19625.0.g104 4.999934616708877e-52
Description: Ribosomal protein S13/S18
DictyBase DDB_G0276415 2.000214949834694e-50
Description: rps18 on chromosome: 2 position 6891141 to 6891920
Stentor Coeruleus SteCoe_37993 3.532628572200807e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00131110(coding)
ATGTCCTTCGTTATCGAAAAAGAATCTGACTTCAAGTACATCCATCGTATCCTCAACACC
AACATCGATGGTAAAAGAATCACCCCTATTGCCTTAACCGGTATTAGAGGTATCGGCAGA
AGATTCGCTTACATCATCTGCAAGGTTTTGAAGATCGATCCCAACGCCAGAGCTGGTTTA
TTAACCGAAGATTAATGCAACAAGATTACCGATCTCATCGCTGATCCCGAAGCTCACGGT
ATCCCCACCTGGTTGCTCAACAGAATTAATGATTTCAAGGATGGTAAAAACTACCAAATG
GCTTCTAACACCTTAGATACCAAGATGAGAGAAGATCTTGAAAGACTCAAGAAAATTAAG
TCTCACAGAGGTCTTAGACATTTCTGGGGTCTCAAGGTTAGAGGTCAACACACCAAGACC
AGTGGTAGACACGGTGTCGTTTGCGGTGTTGTCAGAAAGAACAAATGA


>TTHERM_00131110(gene)
ATGTCCTTCGTTATCGAAAAAGAATCTGACTTCAAGTACATCCATCGTATCCTCAACACC
AACATCGATGGTAAAAGAATCACCCCTATTGCCTTAACCGGTATTAGAGGTATCGGCAGA
AGATTCGCTTACATCATCTGCAAGGTTTTGAAGATCGATCCCAACGCCAGAGCTGGTTTA
TTAACCGAAGATTAATGCAACAAGATTACCGATCTCATCGCTGATCCCGAAGCTCACGGT
ATCCCCACCTGGTTGCTCAACAGAATTAATGATTTCAAGGATGGTAAAAACTACCAAATG
GCTTCTAACACCTTAGATACCAAGATGAGAGAAGATCTTGAAAGACTCAAGAAAATTAAG
TCTCACAGAGGTCTTAGACATTTCTGGGGTCTCAAGGTTAGAGGTCAACACACCAAGACC
AGTGGTAGACACGGTGTCGTTTGCGGTGTTGTCAGAAAGAACAAATGA


>TTHERM_00131110(protein)
MSFVIEKESDFKYIHRILNTNIDGKRITPIALTGIRGIGRRFAYIICKVLKIDPNARAGL
LTEDQCNKITDLIADPEAHGIPTWLLNRINDFKDGKNYQMASNTLDTKMREDLERLKKIK
SHRGLRHFWGLKVRGQHTKTSGRHGVVCGVVRKNK