Identifiers and Description

Gene Model Identifier

TTHERM_00133470

Standard Name

ARP5 (Actin-Related Protein 5)

Aliases

PreTt24270 | 10.m00319 | 3698.m00041

Description

ARP5 actin

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05709.1 9.997093137033517e-262
Description: actin family protein (729 aa)
Oxytricha Contig19647.0.g16 2.000043494209831e-96
Description: Actin
SGD YNL059C 2.998990600740728e-62
Description: ARP5 Nuclear actin-related protein involved in chromatin remodeling, component of chromatin-remodeling enzyme complexes
DictyBase DDB_G0291728 4.001202823045957e-54
Description: arpE on chromosome: 6 position 714429 to 716752
Stentor Coeruleus SteCoe_12903 1.6889118802245324e-48
Description: None
WormBase WBGene00013168 0.000000000003001226732525078
Description: locus:arp-1 status:Confirmed UniProt:Q9NA98 protein_id:CAB70110.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133470(coding)
ATGAAGACATAGAAATATTTAAGAGAGCCTTAAAGATTTTTGATATATGATGTGCGTTAA
TACAATAATCCATTATATGAACCTGCTAGCGATAGAAAACCTACATTGATTTAGAATGAT
TATAATACAGAAATACCAATTTTAATTGACTATGGTAGTGGCATAACAAAAGCTGGTTGG
GGTAATAGTACTAAACCTGATCTCTCAGTGCAATCATTACTTAGCAAGTCTAAAGACTCA
AAAACTAGCATAACTTAGGCATTAACTTCTAGCAAGATAAAAGATGTTGATTTATTCAAG
GGAAATTATAGATCGCCTTATGAAAGAAATATAATATAGCAATTTGGTTTGCTAGAAAAC
CTTAATGATTTTATTTTTAATGAGATTGGTGTAGTTGAATCCAAGGTAGATCATCCTTTG
ATTATAACTGAACCTGTTGCCAACCCAGAATATTGCAGATAAAATTTGCTTGAATAATAT
TTCGAATGTTATGAAATTCCTTCTGTGATGATAGGTGTAGATACATTTTTTGCAACATTT
TATGAATTCGGGTAGGATAGATATCAATCTGAAACATGCTTAATTATAAGTATAGGCCAC
ACCACATGCCACATTATTCCTATGGTAAATGGCTAGATAATTTTTGAAGAAATAAAGAGA
ATAAATGTTGGATATTTTAATAGCTTTGAAGTTCTATATAAGCAGCTTATTTTAAAGAAC
AATCATTAAAAACATCACTTAGATTATTAAACTGTTTAAGCAATACATTTGAATAATTGT
TCTGTTGCTGTTAATTATGATGAATAGCTTAAATATTTAAAATTAGGCACAGATGGTTTC
CAAAATAAATTTTATAGCAATCCTATTGTAAGAGAAAACAACATTCTTACTGATTTAGAG
TGTCTATAAGAACCTATTTACATAGATTTCCCTATACAATAAAAAATTATAGATGAAAGC
GAACTTCTAAGAAAGTAAGAAATTAGATAGAAATAAGCAGAGAGACTTAAAGAAGCAATG
CAAAAAAAAAGGGAAGAGAAAAAAAGAGCTCATGAAAAAGAGTTAGCAGAACTAGAATCA
TTAGAAATTAAATTCAAGGAAGACTAACAATCAGCAAAAATGGTTATAGAGCAGTATTTT
GGTAAAGGTAAGGGAATAGAAGAAGTTCGTAAAAGAATATAAAAAGTCAAAGTAAAACTA
GGCTTTCTCCCAAAAGACACTTTGGAAGAAGATAAATATACCCTAATAAATATTGCAGAT
TCTTAGCTAACAGCTTAGCAACAAAAACAAAAAAAATTACAAATAATACAGAAGCAAGCT
GCAGAAACAAGAGCTGAAAAAAAGGCTCTTGAAAAATAGAAAAAAGAGGAAATAATTAAA
ATGAAAACTTCTAACCCAGAAGTTTATCTGAATATGCTTTATGAAAAAAGATTAAAAATA
ATAAAGAAAGTAGATGAAAAAAAGAAACATCAACAAGAGCTTTCCACTAGAAATTCTAGA
GTTAACTAAAAAAGAATGTAAACTATTGCTTAGTTAGGAGCTTCTGAGAAAATCGGAAAA
GATGATAATTTTGGTATGAACGATGAAGATTGGAATATCTATATTGGCATACAAAAGGAC
TATGAATCAGATGAAGAGAATTAAGAAATGAAGCTAAATGAAATCGAAATAGAATTGAGA
GAAATGGATCCAAATTTTGATGATAAAATCAAAATTGGTGAAGTAAATCCGTACGGTCTT
AGTATGTAAGAACCATTTATAGAACTTTCAGTAGATCGCTTTAGAGGTAACGAAGCTATA
TTCTAGCCAGGAATAGTTGGAGTTGATCAATCAGGTCTTTCAGATGTTATCACATTTGTG
CTTAACAAATTCCCAGCAGAAACATAAGCAAAGCTTCTTTCAAATATAAGAATCACTGGA
GGAGGTAGTGTTATGCAAGGATTAGCTAAAAGAATGGAAAGAGATTTAACTTCTAACTTC
AAGGTAGGAAGTGTTGTTTAAGTTAATCTTATGTCGGAACCTATATTTGGTGCTTGGCTA
GGTATGCAAAAAGTTTATAAATAATATGGAAATAAATTAAATGATTACTTTATTTCTAAG
CAGGAATATTTTGAAAAAGGATCTTCTGAAGGTCTTTTTAAAAGTAATCCTTTTTCAAAT
GTTGTTATTCCTTATTGA


>TTHERM_00133470(gene)
ATGAAGACATAGAAATATTTAAGAGAGCCTTAAAGATTTTTGATATATGATGTGCGTTAA
TACAATAATCCATTATATGAACCTGCTAGCGATAGAAAACCTACATTGATTTAGAATGAT
TATAATACAGAAATACCAATTTTAATTGACTATGGTAGTGGCATAACAAAAGCTGTAATT
TACAATTTTAATTGCTTATTTTTTTAATCGCTTAATATAATTATTTTTGTTAAAGGGTTG
GGGTAATAGTACTAAACCTGATCTCTCAGTGCAATCATTACTTAGCAAGTCTAAAGACTC
AAAAACTAGCATAACTTAGGCATTAACTTCTAGCAAGATAAAAGATGTTGATTTATTCAA
GGGAAATTATAGATCGCCTTATGAAAGAAATATAATATAGCAATTTGGTTTGCTAGAAAA
CCTTAATGATTTTATTTTTAATGAGATTGGTGTAGTTGAATCCAAGGTAGATCATCCTTT
GATTATAACTGAACCTGTTGCCAACCCAGAATATTGCAGATAAAATTTGCTTGAATAATA
TTTCGAATGTTATGAAGTAAAAATATTTACAAAATATCTTTATTTTAAAAAAGATGTTAG
TTAGACGCTAAGGGTGATATATTTTTAAAAATTAGATTCCTTCTGTGATGATAGGTGTAG
ATACATTTTTTGCAACATTTTATGAATTCGGGTAGGATAGATATCAATCTGAAACATGCT
TAATTATAAGTATAGGCCACACCACATGCCACATTATTCCTATGGTAAATGGCTAGATAA
TTTTTGAAGAAATAAAGAGAATAAATGTTGGATATTTTAATAGCTTTGAAGTTCTATATA
AGCAGCTTATTTTAAAGAACAATCATTAAAAACATCACTTAGATTATTAAACTGTTTAAG
CAATACATTTGAATAATTGTTCTGTTGCTGTTAATTATGATGAATAGCTTAAATATTTAA
AATTAGGCACAGATGGTTTCCAAAATAAATTTTATAGCAATCCTATTGTAAGAGAAAACA
ACATTCTTACTGATTTAGAGTGTCTATAAGAACCTATTTACATAGATTTCCCTATACAAT
AAAAAATTATAGATGAAAGCGAACTTCTAAGAAAGTAAGAAATTAGATAGAAATAAGCAG
AGAGACTTAAAGAAGCAATGCAAAAAAAAAGGGAAGAGAAAAAAAGAGCTCATGAAAAAG
AGTTAGCAGAACTAGAATCATTAGAAATTAAATTCAAGGAAGACTAACAATCAGCAAAAG
TAAATTAAAAATTTAAATAGGAATATTTTTTAATAGAGTTGTATGGTGCATTATTAATAT
TATTAATGATTCGATAGATAGATTGATACCTGTTCATATTAGTTTTAGAAATAAATTACT
TTCAATTTGCTAATTCAATTAATAAGTTTGAATTTATTTTTATTTTGGCGGAAGTTATCA
ATCACCAATAAAAATTTTATTTTTCATATTTTCAGAAATATTTTAACAAATATTTATTTT
TTAAAAAAGATGGTTATAGAGCAGTATTTTGGTAAAGGTAAGGGAATAGAAGAAGTTCGT
AAAAGAATATAAAAAGTCAAAGTAAAACTAGGCTTTCTCCCAAAAGACACTTTGGAAGAA
GATAAATATACCCTAATAAATATTGCAGATTCTTAGCTAACAGCTTAGCAACAAAAACAA
AAAAAATTACAAATAATACAGAAGCAAGCTGCAGAAACAAGAGCTGAAAAAAAGGCTCTT
GAAAAATAGAAAAAAGAGGAAATAATTAAAATGAAAACTTCTAACCCAGAAGTTTATCTG
AATATGCTTTATGAAAAAAGATTAAAAATAATAAAGAAAGTAGATGAAAAAAAGAAACAT
CAACAAGAGCTTTCCACTAGAAATTCTAGAGTTAACTAAAAAAGAATGTAAACTATTGCT
TAGTTAGGAGCTTCTGAGAAAGTATTTCAATCTATTTATTTTTAAGAATATTACAATCTA
ATTTACTTTTTATTCATTCAAAGATCGGAAAAGATGATAATTTTGGTATGAACGATGAAG
ATTGGAATATCTATATTGGCATACAAAAGGACTATGAATCAGATGAAGAGAATTAAGAAA
TGAAGCTAAATGAAATCGAAATAGAATTGAGAGAAATGGATCCAAGTAATTCAAAAATAC
TTTTTTTATTTAAAAAATTTTTTTTTCTTCTTTTGAAATTTTTTCTTTGAAGTTATTAAA
TAAAGAAGATTAAATTAATAATTTTATAAAGCAATATTTAATTGGTTTTTTTCTAAAAGA
ATTGCTAATAATTATTCAATTATTTTTAAATATATTTGTTTACTAATATTATTTTATTTT
AGATTTTGATGATAAAATCAAAATTGGTGAAGTAAATCCGTACGGTCTTAGTATGTAAGA
ACCATTTATAGAACTTTCAGTAGATCGCTTTAGAGGTAACGAAGCTATATTCTAGCCAGG
AATAGTTGGAGTTGATCAATCAGGTCTTTCAGATGTTATCACATTTGTGCTTAACAAATT
CCCAGCAGAAACATAAGCAAAGCTTCTTTCAAATATAAGAATCACTGTATTTAAATTAAA
GAAAATAATATTTATTTAATTTTTTTATATATTTACAGGGAGGAGGTAGTGTTATGCAAG
GATTAGCTAAAAGAATGGAAAGAGATTTAACTTCTAACTTCAAGGTAGGAAGTGTTGTTT
AAGTTAATCTTATGTCGGAACCTATATTTGGTGCTTGGCTAGGTATGCAAAAAGTTTATA
AATAATATGGAAATAAATTAAATGATTACTTTATTTCTAAGCAGGAATATTTTGAAAAAG
GATCTTCTGAAGGTCTTTTTAAAAGTAATCCTTTTTCAAATGTTGTTATTCCTTATTGA


>TTHERM_00133470(protein)
MKTQKYLREPQRFLIYDVRQYNNPLYEPASDRKPTLIQNDYNTEIPILIDYGSGITKAGW
GNSTKPDLSVQSLLSKSKDSKTSITQALTSSKIKDVDLFKGNYRSPYERNIIQQFGLLEN
LNDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECYEIPSVMIGVDTFFATF
YEFGQDRYQSETCLIISIGHTTCHIIPMVNGQIIFEEIKRINVGYFNSFEVLYKQLILKN
NHQKHHLDYQTVQAIHLNNCSVAVNYDEQLKYLKLGTDGFQNKFYSNPIVRENNILTDLE
CLQEPIYIDFPIQQKIIDESELLRKQEIRQKQAERLKEAMQKKREEKKRAHEKELAELES
LEIKFKEDQQSAKMVIEQYFGKGKGIEEVRKRIQKVKVKLGFLPKDTLEEDKYTLINIAD
SQLTAQQQKQKKLQIIQKQAAETRAEKKALEKQKKEEIIKMKTSNPEVYLNMLYEKRLKI
IKKVDEKKKHQQELSTRNSRVNQKRMQTIAQLGASEKIGKDDNFGMNDEDWNIYIGIQKD
YESDEENQEMKLNEIEIELREMDPNFDDKIKIGEVNPYGLSMQEPFIELSVDRFRGNEAI
FQPGIVGVDQSGLSDVITFVLNKFPAETQAKLLSNIRITGGGSVMQGLAKRMERDLTSNF
KVGSVVQVNLMSEPIFGAWLGMQKVYKQYGNKLNDYFISKQEYFEKGSSEGLFKSNPFSN
VVIPY