Identifiers and Description

Gene Model Identifier

TTHERM_00133750

Standard Name

CDK7 (Cyclin Dependent Kinase 7)

Aliases

PreTt24298 | 10.m00347 | 3698.m00069

Description

transmembrane protein putative; Cyclin dependent kinase protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05739.1 9.997093137033517e-262
Description: hypothetical protein (369 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133750(coding)
ATGGAATCTAAAACTGATATTAAAAAACATTTAAAACTTCATTACGATATCATCGCAAAC
AAAATTTTGAAAACTGATTTAAACACCCATAAACCTCCTTTTATACCATTTACTTTTTCA
GAATGGAGACGTGATGCATTCAATTCACTTGAAATTGAATTAGAGAAATTATCTTTTGCA
GAAAAGCAAGATTCCAAAAGAGAGTTTATAAATATGGTTGATGGGGATTTGCTTTATTCA
TTCCAAAAGAAGATGAAACAGCCTTATTTTGAACTTGTTTTTTATGATAATTATGCTATT
CCAAAAGGATTGGATTTCTAAGCTGCAAGAAAAGATTATCATTTATTCAAAGACTTAGAA
GCTTTGGCCAACCAAATATCTGAATGGTGCATACAAATAGAAATCAGTGCTGATTTAGTT
GATAGAGCAGAACTTTATAACTACTTTTCATGCGAAAAAGAAGAAAAATAAATTTACAAA
GATTTAAAGGAACAATTATAAGCAAGCTCTAGTAGCAGTGTAGGAGAAAAAATTAGAAAG
TTTTTCAAGAGCACGCTATCCTATAGCATAAAGAGCCTCAGTAACATAGTTTGGACTAAA
GGAATAGCTCTTTCAAATATATCTATGGGAGCTCTCATCTTACTATATTACTCTTTTATT
GGTACTTCTTCTTTACCAGTGCAAATTTTGATGCCTAGAATGCATATATCTTGGCTAGTA
GGAGGTATTGTAGGATCTTACGCTTTAAATAAAGTCGCTGACTCTATAGAACGTGGTGAA
GTAGCAAATAATCTAACTAAAATAACTGAAATATTCAGAGAGATTACTCTAAATTTGATT
GAATTTAATGACAATTGTGAGTATTCTATTAAAGATTGCACACTCTAGAAAACTGAAGAC
GATTTATAGACTAAGTGTTTATAATTGAAGAAAGTTATTAGACACCTGTTGGATAATGCT
GAGAAGTTGACCGAAATGAAAGAAAGAGTTTCTAAACTAAGACATTTAATTGAAAAAGAT
GACGACGAAGACGATGATCTGGTATTAATTGAGCTTGAAGATGTTTAAAAAGAAGATAAT
AAAGAGAAAGCTAAATCAGATTGA


>TTHERM_00133750(gene)
ATGGAATCTAAAACTGATATTAAAAAACATTTAAAACTTCATTACGATATCATCGCAAAC
AAAATTTTGAAAACTGATTTAAACACCCATAAACCTCCTTTTATACCATTTACTTTTTCA
GAATGGAGACGTGATGCATTCAATTCACTTGAAATTGAATTAGAGAAATTATCTTTTGCA
GAAAAGCAAGATTCCAAAAGAGAGTTTATAAATATGGTTGATGGGGATTTGCTTTATTCA
TTCCAAAAGAAGATGAAACAGCCTTATTTTGAACTTGTTTTTTATGATAATTATGCTATT
CCAAAAGGATTGGATTTCTAAGCTGCAAGAAAAGATTATCATTTATGTAAAAATTTTAAA
TTGCATTTTGTTAATATTAACATTTTAAAGTTTTCAAGTTTTAAACCATCAAACCTACTA
AAAAATAAATTTAAAAACCAATAGTCAAAGACTTAGAAGCTTTGGCCAACCAAATATCTG
AATGGTGCATACAAATAGAAATCAGTGCTGATTTAGTTGATAGAGCAGAACTTTATAACT
ACTTTTCATGCGAAAAAGAAGAAAAATAAATTTACAAAGATTTAAAGGAACAATTATAAG
CAAGCTCTAGTAGCAGTGTAGGAGAAAAAATTAGAAAGTTTTTCAAGAGCACGCTATCCT
ATAGCATAAAGAGCCTCAGTAACATAGTTTGGACTAAAGGAATAGCTCTTTCAAATATAT
CTATGGGAGCTCTCATCTTACTATATTACTCTTTTATTGGTACTTCTTCTTTACCAGTGC
AAATTTTGATGCCTAGAATGCATATATCTTGGCTAGTAAAATTATATAAATATTATTTAT
TTGAGAGTTATAATTTAAATTTTTTTATAAGGTAGGAGGTATTGTAGGATCTTACGCTTT
AAATAAAGTCGCTGACTCTATAGAACGTGGTGAAGTAGCAAATAATCTAACTAAAATAAC
TGAAATATTCAGAGAGATTACTCTAAATTTGATTGAATTTAATGACAATTGTGAGTATTC
TATTAAAGATTGCACACTCTAGAAAACTGAAGACGATTTATAGACTAAGTGTTTATGTAT
TAAAGAATTTATATTCTAGCATATTTATTTTTATTACAAAAATTGCAAAAATTTAAATGA
AAAAATAATTTATTTAATTTCTTTAAAATAAATTTTTTAAAAATTATTAGAATTGAAGAA
AGTTATTAGACACCTGTTGGATAATGCTGAGAAGTTGACCGAAATGAAAGAAAGAGTTTC
TAAACTAAGACATTTAATTGAAAAAGATGACGACGAAGACGATGATCTGGTATTAATTGA
GCTTGAAGATGTTTAAAAAGAAGATAATAAAGAGAAAGCTAAATCAGATTGA


>TTHERM_00133750(protein)
MESKTDIKKHLKLHYDIIANKILKTDLNTHKPPFIPFTFSEWRRDAFNSLEIELEKLSFA
EKQDSKREFINMVDGDLLYSFQKKMKQPYFELVFYDNYAIPKGLDFQAARKDYHLFKDLE
ALANQISEWCIQIEISADLVDRAELYNYFSCEKEEKQIYKDLKEQLQASSSSSVGEKIRK
FFKSTLSYSIKSLSNIVWTKGIALSNISMGALILLYYSFIGTSSLPVQILMPRMHISWLV
GGIVGSYALNKVADSIERGEVANNLTKITEIFREITLNLIEFNDNCEYSIKDCTLQKTED
DLQTKCLQLKKVIRHLLDNAEKLTEMKERVSKLRHLIEKDDDEDDDLVLIELEDVQKEDN
KEKAKSD