Identifiers and Description

Gene Model Identifier

TTHERM_00134910

Standard Name

CHS3 (CHitin Synthase)

Aliases

PreTt24315 | 10.m00364 | 3698.m00085

Description

CHS3 chitin synthase; Chitin synthase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05756.1 9.997093137033517e-262
Description: chitin synthase (1532 aa)
SGD YNL192W 8.001824328206442e-49
Description: CHS1 Chitin synthase I, requires activation from zymogenic form in order to catalyze the transfer of N-acetylglucosamine (GlcNAc) to chitin; required for repairing the chitin septum during cytokinesis; transcription activated by mating factor
Oxytricha Contig19394.0.g62 1.9998745702418095e-48
Description: Chitin synthase
Stentor Coeruleus SteCoe_24238 1.0806392777072785e-30
Description: None
WormBase WBGene00000497 0.00000000019994075865167896
Description: locus:chs-2 status:Confirmed UniProt:G5EBQ8 protein_id:CCD71483.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00134910(coding)
ATGAATAAGACTGTTATTCACGACAATACTTACGTGTCTACAGACAGAATAAAAAAGATT
TTATAGCCCATAGAGCTCTAGTTAGCTAAGGGTTAAAACAATTCTTTTAAGCTTTCTTCA
AGAACTTTGACATAATAAAATTGGGCAAACGATATTTAAAACAAAAAATTCCAGTCCTTA
GAATAAGAAAGCCTTAGCGTTGAATAGGTTCTGAAGGTAGGAGTTCAAAATGGTTTAGTT
TCATTGTTTAACAGATTTAACGATGGTATCTGCATCAAACCTAAAATGATTATTTGCGTT
ACCATGTATAATGAACCACGTAAAGAACTAGAGGAAACATTAGATGGTATAGTTAGCAAC
ATTTCAACTTTTAAAGAAGAATGTAATATCTCTAATAATGAAATTTTGGTCATTGTTGTG
TATGATGGTATTGATAGAATGAATGCTAGTAAAGATAGCGATGACAGTATGTTAGACTAC
TTTAGTACCTGGGATGAAGTTGTAAAGACTTAAAGATAAAGTGAACAAAGAAGAACTATG
AGATAAGAGTATGATGAATATTGTTATAATCTTAAAATCTCTAAGTTAGATGTTGAAAAA
ATTAAGTCAAATGATTTCAAAGAAATGAATTCTGATTCTAAATTAATGAAAGGATTTAAT
GACTATAAAATTGAAAATCGTGATGACAAAAGAACTTTAGAATAACAAAAGTCAGAATTT
CTTTACAAAAAGAAAGAAGAAGCAGGAAAGTATCTCAAAGATAAAGCAAATAATGCTTAC
CTCTACTAGATGAGACATAGACTTCAAAAAGCCACATCTGGAGGAGAAGACGGAGATAGC
TAAGAATTCCTTGATTCTGATGATACTCTTAATATTATGCATTGCGTTAAATATTAAAAT
GGTGGTAAATTATCAAGTCACTTGTGGTTCTTTTGCGGTTTTTGTGAACTTTTCAATCCA
GACTATACTATTCTATTAGATTGTGGTTTAGTTCCTGATGAGAGAGCTATGTTTAATATG
TTTTTAGCTTTGGAAAGTGATAAGAATATTGGTGGTGTTTGTGGTTTTATGGGTATAAAA
TTCTAAGATATTTATACTGAAGGTGGTGAAAGAAATGATAACTACAATGAAAATGAAATT
AACTGTATTGCAGATATGTATTAAAGAGTATTTAACATACAAAGAGCTTAAATGTATGAA
TATAATATGGGTCACTTTATTGATAAGCCTTTTGAATCTCTATTCGGCTATATTTAGGTG
CTTCCTGGTGCTTTCTCTGGTTATAGATGGGAAGCGCTAAAGAGAGATGATGATAATGAA
AGTATTCTTGATGATTATCTCAGCAGTGTTTTGGATAAAGATTAAGAATTAACTCTAGAA
CAAGAAAATATGAACTTGGCAGAAGATAGAATTCTCTGTTTGAAAATTTACTCTAAAAGA
GGAAAAAGATATACTCTTCGTTATTTGCCTAATTGCAAAGCTAGAGTCGATCCTGTCACT
AATCTGATGGTTTTAACTTCATAAAGAAGAAGATGGATTAACGGTTCTACTTTCGCCTTA
AGAATGTGCTTAGAAAATAAAAGTATAATTTATGAATCAAATCACTCTGCTTTTGAGTTG
TGCCTTTTCAAATTCTGTATGTCATTTGCTTGGCTCAATGATGCTTTGAGTTATATCTCT
CTCTCTGTTTACTTCACAATCGTTTTTATTATGTTGATGACCAATGTTAGTTCAGTCACT
CTCGATGGTGCTATTAATACTGGCTCAGCACTTGCAGTTTTCTTTGTTACTCTCTTCCTT
TCTTCTTACTTTTTAGTTGTCTTAATGATTATTTTCTACTCTTTATCATTCGATACGAGA
AATAGGCAAATGCATTAGATATTCTATTCTCTCTCTGCTTATTTAGGTGTTTTGATGATA
ATTGCTTATGTTATTATGCTTATCTATATTATCCAAATTACTATTTTTACTATCTAAAAA
TACATACTTGGACACGAGTCTGGATTTGGAACTGATGGTGTTTTAAGTTCTTGGAGTGAT
GATGGATGGACTAAAAAGACTTTCTGCTACTTAGTTGTCGTTGGTTTCTTTATCAACTTT
GTCCCATATATTTTCAATTTATCTAGAATTTGCGAAATGTTAAAATCTTTTATTCATTTT
GTAGCCTATTAGTCATAATATATTCATTTACTTTTGATTTATGCTTTCTGTAGAATTGAT
GATCTTTCTTGGGGTACTAAAGGTTCTGATGTTTCTAGCTCTTAAAAGGATGTAAGTAAA
AAAATTAAATTCAGCTTCGTTACTAAATGGTTCCTTGTCAATGTTATTCTTGGATTCTTA
TTTGGTACTTTCTTAACCAGTCAAGTCCTTGACTAGTAGTCTTAATATTAATATGTCAAG
CCCTTTATTTTGATTGGTATTTCTGTCGTTTTCGTAGATGAGCAACAAGAAGAGACATAT
TAAGAAAGAAAGAATGAACAGCAACCTTAATGA


>TTHERM_00134910(gene)
ATGAATAAGACTGTTATTCACGACAATACTTACGTGTCTACAGACAGAATAAAAAAGATT
TTATAGCCCATAGAGCTCTAGTTAGCTAGTAAAATTATTTAATATGCTTTACAAATCAAT
TTAACATAAATATAATGATTTCGATACTTATTTATTAACCTTATTCTATGATTATTATTA
GAGGGTTAAAACAATTCTTTTAAGCTTTCTTCAAGAACTTTGACATAATAAAATTGGGCA
AACGATATTTAAAACAAAAAATTCCAGTCCTTAGAATAAGAAAGCCTTAGCGTTGAATAG
GTTCTGAAGGTAGGAGTTCAAAATGGTTTAGTTTCATTGTTTAACAGATTTAACGATGGT
ATCTGCATCAAACCTAAAATGATTATTTGCGTTACCATGTATAATGAACCACGTAAAGAA
CTAGGTATCATAATTGAACTTACATAAATTTGAATAAAAAAATAGCTTACTTATCATATC
TTATTTGATTCTTTAAATAAAAATTAGAGGAAACATTAGATGGTATAGTTAGCAACATTT
CAACTTTTAAAGAAGAATGTAATATCTCTAATAATGAAATTTTGGTCATTGTTGTGTATG
ATGGTATTGATAGAATGAATGCTAGTAAAGATAGCGATGACAGTATGTTAGACTACTTTA
GGTAATATAACATTTATTTTGTGAATTCTAAAACGAAATACATTTTTATTTTTTATGAAT
TGAGAAAAAAATACAGCTCAATTCTTTAAATCATACTTGCTAGGATTATTAAATTAATAT
CTAAAATTTATTTTTTATCAACTTTAAAATAAAATTCAAACTTAAGATTTATTATGTAAA
CCTAAATAGTACCTGGGATGAAGTTGTAAAGACTTAAAGATAAAGTGAACAAAGAAGAAC
TATGAGATAAGAGTATGATGAATATTGTTATAATCTTAAAATCTCTAAGTTAGATGTTGA
AAAAATTAAGTCAAATGATTTCAAAGAAATGAATTCTGATTCTAAATTAATGAAAGGATT
TAATGACTATAAAATTGAAAATCGTGATGACAAAAGAACTTTAGAATAACAAAAGTCAGA
ATTTCTTTACAAAAAGAAAGAAGAAGCAGGAAAGTATCTCAAAGATAAAGCAAATAATGC
TTAGTAAGCAATTTTTAAAAAAATTAAATAATTTTAATTAAATAATATTTTATTTAATTA
ATTAAGCCTCTACTAGATGAGACATAGACTTCAAAAAGCCACATCTGGAGGAGAAGACGG
AGATAGCTAAGAATTCCTTGTAATTAATTTTTAATTTATTTATATTTTTTAATAGCTATT
CTCAATAAATTATAAAGGATTCTGATGATACTCTTAATATTATGCATTGCGTTAAATATT
AAAATGGTGGTAAATTATCAAGTCACTTGTGGTTCTTTTGCGGTTTTTGTGAACTTTTCA
ATCCAGACTATACTATTCTATTAGATTGTGGTTTAGTTCCTGATGAGAGAGCTATGTTTA
ATATGTTTTTAGCTTTGGAAAGTGATAAGAATATTGGTGGTGTTTGTGGTTTTATGGGTA
TAAAATTCTAAGATATTTATACTGAAGGTGGTGAAAGAAGTAATTTAGATATTATATTGA
TACAACTTTTATATTAATTGTTTTATTATTCTTGAAAAGATGATAACTACAATGAAAATG
AAATTAACTGTATTGCAGATATGTATTAAAGAGTATTTAACATACAAAGAGCTTAAATGT
ATGAATATAATATGGGTAATTTATTTTTATCAACTTATTGATTTTATTAATTCTTAAATT
GATAATAAAGGTCACTTTATTGATAAGCCTTTTGAATCTCTATTCGGCTATATTTAGGTG
CTTCCTGGTGCTTTCTCTGGTTATAGATGGGAAGCGCTAAAGAGAGATGATGATAATGAA
AGTATTCTTGATGATTATCTCAGCAGTGTTTTGGATAAAGATTAAGAATTAACTCTAGAA
CAAGAAAATATGAACTTGGCAGAAGATAGAATTCTCTGTTTGAAAATTTACTCTAAAAGA
GGAAAAAGATATACTCTTCGTTATTTGCCTAATTGCAAAGCTAGAGTCGATCCTGTCACT
AATCTGATGGTTTTAACTTCATAAAGAAGTAAAATTTTACAACAAAAAAATATTAAATAA
AATCCCTAAATTAATTATTATAAAAACAGGAAGATGGATTAACGGTTCTACTTTCGCCTT
AAGAATGGTAATTAACTAATTTTTAGTGGAATTTGCATACTTAAATTCTTTATTTTAATC
TAAAAGTGCTTAGAAAATAAAAGTATAATTTATGAATCAAATCACTCTGCTTTTGAGTTG
TGCCTTTTCAAATTCTGTATGTCATTTGCTTGGCTCAATGATGTAAAAATTAAAAAATTA
TTTAGAGAATCATTTTATTTTTTATTTGTAAAGGCTTTGAGTTATATCTCTCTCTCTGTT
TACTTCACAATCGTTTTTATTATGTTGATGACCAATGTTAGTTCAGTCACTCTCGATGGT
GCTATTAATACTGGCTCAGCACTTGCAGTTTTCTTTGTTACTCTCTTCCTTTCTTCTTAC
TTTTTAGTTGTCTTAATGATTATTTTCTACTCTTTATCATTCGATACGAGAAATAGGCAA
ATGCATTAGATATTCTATTCTCTCTCTGCTTATTTAGGTAACAAACAAACAAATCTTTTT
ATCTTTTTATAAAAACTAATTTAAATAATTTCAATTTCTAAGTTATAATTTTAAATTTAT
AAAATAGGTGTTTTGATGATAATTGCTTATGTTATTATGCTTATCTATATTATCCAAATT
ACTATTTTTACTATCTAAAAATACATACTTGGACACGAGTCTGGATTTGGAACTGATGGT
GTTTTAAGTTCTTGGAGTGATGATGGATGGACTAAAAAGACTTTCTGCTACTTAGTTGTC
GTTGGTTTCTTTATCAACTTTGTCCCATATATTTTCAATTTATCTAGAATTTGCGAAATG
TTAAAATCTTTTATTCATTTTGTAGCCTATTAGTCATAATATATTCATTTACTTTTGATT
TATGCTTTCTGTAGAATTGATGATCTTTCTTGGGGTACTAAAGGTTCTGGTAATTAAAAA
TATTAGCCCTGTTTCTTTTTTTAGTTATTAAATTTATTTTTATATGAAAAAAGATGTTTC
TAGCTCTTAAAAGGATGTAAGTAAAAAAATTAAATTCAGCTTCGTTACTAAATGGTTCCT
TGTCAATGTTATTCTTGGATTCTTATTTGGTACTTTCTTAACCAGTCAAGTCCTTGACTA
GTAGTCTTAATATTAATATGTCAAGCCCTTTATTTTGATTGGTATTTCTGTCGTTTTCGT
AGGTTAATTGGCTATCAGAGTTGTTGGAGCTGTCTTGTATGAGTTAAAGTTCTTATTCTT
CATGATAAAGATGAGCAACAAGAAGAGACATATTAAGAAAGAAAGAATGAACAGCAACCT
TAATGA


>TTHERM_00134910(protein)
MNKTVIHDNTYVSTDRIKKILQPIELQLAKGQNNSFKLSSRTLTQQNWANDIQNKKFQSL
EQESLSVEQVLKVGVQNGLVSLFNRFNDGICIKPKMIICVTMYNEPRKELEETLDGIVSN
ISTFKEECNISNNEILVIVVYDGIDRMNASKDSDDSMLDYFSTWDEVVKTQRQSEQRRTM
RQEYDEYCYNLKISKLDVEKIKSNDFKEMNSDSKLMKGFNDYKIENRDDKRTLEQQKSEF
LYKKKEEAGKYLKDKANNAYLYQMRHRLQKATSGGEDGDSQEFLDSDDTLNIMHCVKYQN
GGKLSSHLWFFCGFCELFNPDYTILLDCGLVPDERAMFNMFLALESDKNIGGVCGFMGIK
FQDIYTEGGERNDNYNENEINCIADMYQRVFNIQRAQMYEYNMGHFIDKPFESLFGYIQV
LPGAFSGYRWEALKRDDDNESILDDYLSSVLDKDQELTLEQENMNLAEDRILCLKIYSKR
GKRYTLRYLPNCKARVDPVTNLMVLTSQRRRWINGSTFALRMCLENKSIIYESNHSAFEL
CLFKFCMSFAWLNDALSYISLSVYFTIVFIMLMTNVSSVTLDGAINTGSALAVFFVTLFL
SSYFLVVLMIIFYSLSFDTRNRQMHQIFYSLSAYLGVLMIIAYVIMLIYIIQITIFTIQK
YILGHESGFGTDGVLSSWSDDGWTKKTFCYLVVVGFFINFVPYIFNLSRICEMLKSFIHF
VAYQSQYIHLLLIYAFCRIDDLSWGTKGSDVSSSQKDVSKKIKFSFVTKWFLVNVILGFL
FGTFLTSQVLDQQSQYQYVKPFILIGISVVFVDEQQEETYQERKNEQQPQ