Identifiers and Description

Gene Model Identifier

TTHERM_00136330

Standard Name

MXR2 (Methionine sulfoXide Reductase)

Aliases

PreTt24358 | 10.m00407 | 3698.m00126

Description

methionine-R-sulfoxide reductase; methionine (R)-sulfoxide reductase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05798.1 1.99970314379378e-94
Description: methionine-R-sulfoxide reductase (211 aa)
WormBase WBGene00018419 3.00039543526891e-44
Description: status:Confirmed UniProt:Q1W0S5 protein_id:CCD71224.1
DictyBase DDB_G0291145 5.001425520048966e-32
Description: msrB on chromosome: 5 position 5047547 to 5048311
SGD YCL033C 3.99801309251602e-27
Description: MXR2 Methionine-R-sulfoxide reductase, involved in the response to oxidative stress; protects iron-sulfur clusters from oxidative inactivation along with MXR1; involved in the regulation of lifespan
Stentor Coeruleus SteCoe_26033 3.532628572200807e-24
Description: None
Oxytricha Contig11900.0.g26 3.0007793728221555e-22
Description: SelR domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136330(coding)
ATGATTAGACTAATTAATAATTTCAGTAAACAAATAAAAAATACAACAAACAAAAAATAT
CTGCTAATACCTTTAATAGCATATTCATTTGTGAAATCTCAACCAAAGTAGATTTAACTC
TATACATAACCCAATCAACAATAATTTTCGTCTTCACCAATGCAAAAGTAGGAATTCCCT
TTCAAAGTTAATAAAGAAGAATTAAAAAAACGTTTAACACCTATTCAATATAAAGTTACT
TAAGAAGCTGACACAGAACGTCCTTATACAGGATAATACGATAAGCATTTTGAATAAGGT
GAATATTTATGTATCGTATGCTCTGAGAAGTTATTTAATTCAGACAGCAAATTTAATTCA
GGTTGCGGATGGCCTGCTTTTTCCTCAAGTGAGTAGGGAAAGATTTAAGAAAATGTAGAC
CAATCTCATGGTATGGTAAGAACTGAGGTTGTTTGCAAAAATTGTGGTGCACATTTAGGT
CATGTTTTCAATGATGGTCCTAAGCCCACTCATCTCCGTTACTGTATCAACTCTGCCTCA
ATTAACTTCAAAAAAGCTAATTGA


>TTHERM_00136330(gene)
ATGATTAGACTAATTAATAATTTCAGTAAACAAATAAAAAATACAACAAACAAAAAATAT
CTGCTAATACCTTTAATAGCATATTCATTTGTGAAATCTCAACCAAAGTAGATTTAACTC
TATACATAACCCAATCAACAATAATTTTCGTCTTCACCAATGCAAAAGTAGGAATTCCCT
TTCAAAGTTAATAAAGAAGAATTAAAAAAACGTTTAACACCTATTCAATATAAAGTTACT
TAAGAAGCTGACACAGAACGTCCTTATACAGGATAATACGATAAGCATTTTGAATAAGGT
GAATATTTATGTATCGTATGCTCTGAGAAGTTATTTAATTCAGACAGCAAATTTAATTCA
GGTTGCGGATGGCCTGCTTTTTCCTCAAGTGAGTAGGGAAAGATTTAAGAAAATGTAGAC
CAATCTCATGGTATGGTAAGAACTGAGGTTGTTTGCAAAAATTGTGGTGCACATTTAGGT
CATGTTTTCAATGATGGTCCTAAGCCCACTCATCTCCGTTACTGTATCAACTCTGCCTCA
ATTAACTTCAAAAAAGCTAATTGA


>TTHERM_00136330(protein)
MIRLINNFSKQIKNTTNKKYLLIPLIAYSFVKSQPKQIQLYTQPNQQQFSSSPMQKQEFP
FKVNKEELKKRLTPIQYKVTQEADTERPYTGQYDKHFEQGEYLCIVCSEKLFNSDSKFNS
GCGWPAFSSSEQGKIQENVDQSHGMVRTEVVCKNCGAHLGHVFNDGPKPTHLRYCINSAS
INFKKAN