Identifiers and Description

Gene Model Identifier

TTHERM_00136430

Standard Name

RRM2 (RNA Recognition Motif-containing protein 2)

Aliases

PreTt24368 | 10.m00417 | 3698.m00136

Description

RRM2 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF02392 ) Ycf4
  • ( PF08777 ) RNA binding motif
  • ( TIGR01628 ) polyadenylate binding protein, human types
  • ( TIGR01661 ) ELAV/HuD family splicing factor

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05809.1 9.997093137033517e-262
Description: hypothetical protein (1293 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136430(coding)
ATGAGTTAAATACCAGAAAAGGGAGAATACAATTCTATTTTGATTCACAACATACCAGAA
AATGTTACGAGAGAGGAGATTTAAAACTCCTTCAAAAAGTTTGGCACTATCAAGAATATA
TAAAGTTTTAAGCGCAAGAACTACACCATAAGAATAGAATATACAAATTCTGAAGATGCA
TAAAAAGCTATGAAAGAAATGAACTTTCACACTTTTTAAGGCGAAGAAATCAATATTCAA
TTCTTTTTAGATAAGGAGAAGAAGGAATAAATTAAGCATAACAATATTGTCATTAAGAAT
GTTCCTATTAATATCAGCTAAACAGACCTTTTTGAAGCTTTTAGCATGCACGGAGATATT
TTTTCTCTTTACCTCAAAAAAGGAGTAGATAAAGCAAATGTAGGAATAGGATATGTTTAA
TTCTTTAAAAATGCAGATAAAATCAAGATACTTGAATTGTAGGATTCATAAGGAGGCGAG
CTAACACTAAATCTGAAAAACGATACCGAAATTAAGCTAAAGCTTGAGGAATTCTATTCA
AAGAATGAAGAAGAGGCTATATTGATGTAAAAGTAGTAGCAATAATAGTAGATTTAACTA
TAACAACAATAATAAATTTCTTAAGGGTAGGTTGAGTAATCTTCAGGAGAACTAAAGATA
GAAGCCCAACCTGGAGTTTAAAATTTGACCATTCAGTCAGCACTAATACCATAAATTTAA
TAGCTTTAGCAAAATTCTTTGCAATAAAGTATAGCAAATTAGGTAAATAATACTCAATAG
CTCTAGCAATCTATCATTTAATAAACTCTTTCTCCCCAAGCTTTATAATTACCTAACTAA
TCTGATAATTCTTAAGCTTCTACTGCTGTTGTTGCGTCAAATATAGAATATGTTGTAATT
TTTATTAAAAATTTTATGGAAAAGGAAATTAGCACGTCTGAATCTAATGAGATAAGCTAA
GCTTTAAAAAATATAGAAATTAGCATTAAATAAGTTATTGAAAAAGTTTAAAATGAGCTC
AAAGGCAGTGCTCCTAAATTAGAATTTTATGTTTAATATAATGCACAGAAAAAAAATTTC
TGGAGTCATTTGTTTGGAGTGGGTACAGCTGATGTTTTTCAAAATATATTTGAAATTACT
TCTAAACTGCTCAAACAGACTTATCCTTCATGCGAAGTAAGCTTTAAGTAGAAAAAGAAA
TAGCAAGAACCATCAGCAAAGCATCTTATTTGTTTTGGAGTGAGACCAACTATAACTCAT
GAAAAAATAAAACAATGGCTCGAAGATCAGATTTTTAGTAGCCTAACTGTTTCATCTATA
AGCTTCAATTTAGTCAAAAAGAAAGAAAGTAGCACTTCAACTCAATCTTCAAAAAATTTT
GAAAAAGATTCATAAGTGCTCTACATCTTCTTTTTAAATGAATAAGAAGGCATTTAGTTT
ATGGAAATATGCAAAAAGAACTTAGCTCACACAAACAACATTTTTTATAAGCCAAAGATT
TCTTAATACCTAACAGATAAGCAAAGGTAAGATTTGAAAGCTAAAATGAATCAAAATAAT
TCTAACAATCTAGGCAGTTAAGGCTATTCAAGCAACCATTAAAATTACTAAAATCACCAC
TACCAATAGGGAAATTCAAACAACCATCACCAAGTATATCACCACAACAACGGCAACAAC
AACAATCACAATTATAACCACAATCACCACCATCACCATAATTATAATTAAAATAACCAC
TACAATCCTAATTAGCATCATTATTATACTAATAATAACAATTAAAATTAAACTAGCAAT
CATAATCATCATCATCATCATCACCACAACAATATAAATAATACTGCTTATCATAATAAT
AATCCCAGCTATCATAATAAAAACCAGTAGCATTCTTAGCAGGGAAATAGCCATAGCCAC
AATCACTATTAAGCTGGAAATCATCACTTCCATTAGGCTAATTTTAATTAATCTCATAAT
AGCAACCATCATAATGGAAATAACAGTCACCACAGCTAGCATTCTTAGCATCCCAATCAT
TAGTCTGGGTATAATAATTAGAATCAAGCTGGTTAATAGAGCAGGTAAAGAAATAGTAAA
TCTATGAATTATAGAACTAATTAAGCAGGAAATAACTCAAGTACTAACTATCAAGGAGGT
TAGAATTATTTAGGAACTAATGGGTAAAATAATGCTAGTTCAAGTTCAAGCTAATAAAAT
CAAAGTAACCAAACTAATCAACAGCAAAGAGGTAGCTAAAATATTAGCTCCTCACAATAA
AACAATCAATATAATTATGGATAAGGAAATAGTCAAAATAATTAAATGCAGTAAAGAAAT
ACCGCATACGCTTAGCATAGATCATAGATTAATAATTAAAATAACTCATAATAAAGTGTT
CACTAAGGTACAAAGAATATACCAAGCAACTACACATAGCACCACTAAAAGAATTAAGGC
ATGCAAAATGAAAATACTAGAAATAATAGAACTAGAAATTAGAACAATCAGCATAGCATG
AACAGTAATCATCACAGCCACATTGCAAATAGTCAATAAGGAAATAACAATTAAAATAAT
TATCATAACAATAGTTAATCATATGCTTCATCTGGAAATTCTTTCTTACCTAATTATGCT
AATAACCATTAACGTATTGATTAATATTCTTAGAGTGCTAATATTCATAATAGCAATAAC
AATCGTAGGTCACAAAACAATAATGTGAATAGCAGTAATTTGAGCTCTGGAAATAATAAC
AATTTTGATAATAATAATAACAAACAAAATTTCACAAATAGCAAAAGTGAGACTAATAAC
AGCTACACTAGCACTTCAAGTTAAGGAACTGCCTAAATATATGTTTAGAAAAATTAATAA
AATTCTAATAATAGCAATGGCAATAAGCACTTCAATGGCTCTAGCAGTGGATTAAATAAT
TCTTATAGTAGTTTTACATCTCCTCCTTAAGGAAACAGAGTAAATAACGCTAATAACACT
CAAGGAGGTACTTTGAATACATTTGATACATTCCCTAGTAATCATATTACTTAAAATACC
AACTCATTTGGAAATATTGGAAGAGGTACTAATAGTAGTAATTTCCATAACACAAATTCA
TCTACAAACTAAACAGTAGCATAATAATAAAATTACTCAAATAATACTAATAATTAGTAA
TACTTTTAAGCCAATAGCAATAAGAACTAAAATTATTTTAGTCCTCTAGGCGTGAACAGC
TAATCTCAATAATAGAATTAAGTTGGATAAGCTAATGGAAGCATCTAAAATAAATCTACC
AATTACTTGGTAAATATTTCTTCAAACAACCTGATTGTAAATCCCAATAACTCAACTGCC
AACACGACAGCTACAGCATCTCCAACTACTGCTTCGTCATAAAATGTAGTAAATTCAATG
TCTAGTAATGCATTTACATCATCTCTGAGTAGCTATATAATAGCTTTGAGCAACGCAAAT
ACTCAGCAAGTATAGCAAAATGTAATTGAAAACCTTAGAAATGAAGTTCTAAATAACAAA
GTAGAATTTAAGGCTCTTTAGGATAAAGATTTAAAAAATAAAACTATTTCATATATAATT
AAATAAATGATTATCAATTTATCAAGCGCTGAAGAAAAGGTAGGCTAATTACTCCAAATC
AAAGAAAGTGATAAAATCAAAGCAAAAGTAGAACATTTTATTTCAATTAATGAGTAAATA
TGCCAGCTTTTCACAAATTGTGTATTTAGCACTGACGAGATTCTGCAAATAATCGAAGAT
TAAAATTAACTTGTTCAAAAATGTGAATATTTCACAAAGCTAAAAACATCTTGA


>TTHERM_00136430(gene)
ATGAGTTAAATACCAGAAAAGGGAGAATACAATTCTATTTTGATTCACAACATACCAGAA
AATGTTACGAGAGAGGAGATTTAAAACTCCTTCAAAAAGTTTGGCACTATCAAGAATATA
TAAAGTTTTAAGCGCAAGAACTACACCATAAGAATAGAATATACAAATTCTGAAGATGCA
TAAAAAGCTATGAAAGAAATGAACTTTCACACTTTTTAAGGCGAAGAAATCAATATTCAA
TTCTTTTTAGATAAGGAGAAGAAGGAATAAATTAAGCATAACAATATTGTCATTAAGAAT
GTTCCTATTAATATCAGCTAAACAGACCTTTTTGAAGCTTTTAGCATGCACGGAGATATT
TTTTCTCTTTACCTCAAAAAAGGAGTAGATAAAGCAAATGTAGGAATAGGATATGTTTAA
TTCTTTAAAAATGCAGATAAAATCAAGATACTTGAATTGTAGGATTCATAAGGAGGCGAG
CTAACACTAAATCTGAAAAACGATACCGAAATTAAGCTAAAGCTTGAGGAATTCTATTCA
AAGAATGAAGAAGAGGCTATATTGATGTAAAAGTAGTAGCAATAATAGTAGATTTAACTA
TAACAACAATAATAAATTTCTTAAGGGTAGGTTGAGTAATCTTCAGGAGAACTAAAGATA
GAAGCCCAACCTGGAGTTTAAAATTTGACCATTCAGTCAGCACTAATACCATAAATTTAA
TAGCTTTAGCAAAATTCTTTGCAATAAAGTATAGCAAATTAGGTAAATAATACTCAATAG
CTCTAGCAATCTATCATTTAATAAACTCTTTCTCCCCAAGCTTTATAATTACCTAACTAA
TCTGATAATTCTTAAGCTTCTACTGCTGTTGTTGCGTCAAATATAGAATATGTTGTAATT
TTTATTAAAAATTTTATGGAAAAGGAAATTAGCACGTCTGAATCTAATGAGATAAGCTAA
GCTTTAAAAAATATAGAAATTAGCATTAAATAAGTTATTGAAAAAGTTTAAAATGAGCTC
AAAGGCAGTGCTCCTAAATTAGAATTTTATGTTTAATATAATGCACAGAAAAAAAATTTC
TGGAGTCATTTGTTTGGAGTGGGTACAGCTGATGTTTTTCAAAATATATTTGAAATTACT
TCTAAACTGCTCAAACAGACTTATCCTTCATGCGAAGTAAGCTTTAAGTAGAAAAAGAAA
TAGCAAGAACCATCAGCAAAGCATCTTATTTGTTTTGGAGTGAGACCAACTATAACTCAT
GAAAAAATAAAACAATGGCTCGAAGATCAGATTTTTAGTAGCCTAACTGTTTCATCTATA
AGCTTCAATTTAGTCAAAAAGAAAGAAAGTAGCACTTCAACTCAATCTTCAAAAAATTTT
GAAAAAGATTCATAAGTGCTCTACATCTTCTTTTTAAATGAATAAGAAGGCATTTAGTTT
ATGGAAATATGCAAAAAGAACTTAGCTCACACAAACAACATTTTTTATAAGCCAAAGATT
TCTTAATACCTAACAGATAAGCAAAGGTAAGATTTGAAAGCTAAAATGAATCAAAATAAT
TCTAACAATCTAGGCAGTTAAGGCTATTCAAGCAACCATTAAAATTACTAAAATCACCAC
TACCAATAGGGAAATTCAAACAACCATCACCAAGTATATCACCACAACAACGGCAACAAC
AACAATCACAATTATAACCACAATCACCACCATCACCATAATTATAATTAAAATAACCAC
TACAATCCTAATTAGCATCATTATTATACTAATAATAACAATTAAAATTAAACTAGCAAT
CATAATCATCATCATCATCATCACCACAACAATATAAATAATACTGCTTATCATAATAAT
AATCCCAGCTATCATAATAAAAACCAGTAGCATTCTTAGCAGGGAAATAGCCATAGCCAC
AATCACTATTAAGCTGGAAATCATCACTTCCATTAGGCTAATTTTAATTAATCTCATAAT
AGCAACCATCATAATGGAAATAACAGTCACCACAGCTAGCATTCTTAGCATCCCAATCAT
TAGTCTGGGTATAATAATTAGAATCAAGCTGGTTAATAGAGCAGGTAAAGAAATAGTAAA
TCTATGAATTATAGAACTAATTAAGCAGGAAATAACTCAAGTACTAACTATCAAGGAGGT
TAGAATTATTTAGGAACTAATGGGTAAAATAATGCTAGTTCAAGTTCAAGCTAATAAAAT
CAAAGTAACCAAACTAATCAACAGCAAAGAGGTAGCTAAAATATTAGCTCCTCACAATAA
AACAATCAATATAATTATGGATAAGGAAATAGTCAAAATAATTAAATGCAGTAAAGAAAT
ACCGCATACGCTTAGCATAGATCATAGATTAATAATTAAAATAACTCATAATAAAGTGTT
CACTAAGGTACAAAGAATATACCAAGCAACTACACATAGCACCACTAAAAGAATTAAGGC
ATGCAAAATGAAAATACTAGAAATAATAGAACTAGAAATTAGAACAATCAGCATAGCATG
AACAGTAATCATCACAGCCACATTGCAAATAGTCAATAAGGAAATAACAATTAAAATAAT
TATCATAACAATAGTTAATCATATGCTTCATCTGGAAATTCTTTCTTACCTAATTATGCT
AATAACCATTAACGTATTGATTAATATTCTTAGAGTGCTAATATTCATAATAGCAATAAC
AATCGTAGGTCACAAAACAATAATGTGAATAGCAGTAATTTGAGCTCTGGAAATAATAAC
AATTTTGATAATAATAATAACAAACAAAATTTCACAAATAGCAAAAGTGAGACTAATAAC
AGCTACACTAGCACTTCAAGTTAAGGAACTGCCTAAATATATGTTTAGAAAAATTAATAA
AATTCTAATAATAGCAATGGCAATAAGCACTTCAATGGCTCTAGCAGTGGATTAAATAAT
TCTTATAGTAGTTTTACATCTCCTCCTTAAGGAAACAGAGTAAATAACGCTAATAACACT
CAAGGAGGTACTTTGAATACATTTGATACATTCCCTAGTAATCATATTACTTAAAATACC
AACTCATTTGGAAATATTGGAAGAGGTACTAATAGTAGTAATTTCCATAACACAAATTCA
TCTACAAACTAAACAGTAGCATAATAATAAAATTACTCAAATAATACTAATAATTAGTAA
TACTTTTAAGCCAATAGCAATAAGAACTAAAATTATTTTAGTCCTCTAGGCGTGAACAGC
TAATCTCAATAATAGAATTAAGTTGGATAAGCTAATGGAAGCATCTAAAATAAATCTACC
AATTACTTGGTAAATATTTCTTCAAACAACCTGATTGTAAATCCCAATAACTCAACTGCC
AACACGACAGCTACAGCATCTCCAACTACTGCTTCGTCATAAAATGTAGTAAATTCAATG
TCTAGTAATGCATTTACATCATCTCTGAGTAGCTATATAATAGCTTTGAGCAACGCAAAT
ACTCAGCAAGTATAGCAAAATGTAATTGAAAACCTTAGAAATGAAGTTCTAAATAACAAA
GTAGAATTTAAGGCTCTTTAGGATAAAGATTTAAAAAATAAAACTATTTCATATATAATT
AAATAAATGATTATCAATTTATCAAGCGCTGAAGAAAAGGTAGGCTAATTACTCCAAATC
AAAGAAAGTGATAAAATCAAAGCAAAAGTAGAACATTTTATTTCAATTAATGAGTAAATA
TGCCAGCTTTTCACAAATTGTGTATTTAGCACTGACGAGATTCTGCAAATAATCGAAGAT
TAAAATTAACTTGTTCAAAAATGTGAATATTTCACAAAGCTAAAAACATCTTGA


>TTHERM_00136430(protein)
MSQIPEKGEYNSILIHNIPENVTREEIQNSFKKFGTIKNIQSFKRKNYTIRIEYTNSEDA
QKAMKEMNFHTFQGEEINIQFFLDKEKKEQIKHNNIVIKNVPINISQTDLFEAFSMHGDI
FSLYLKKGVDKANVGIGYVQFFKNADKIKILELQDSQGGELTLNLKNDTEIKLKLEEFYS
KNEEEAILMQKQQQQQQIQLQQQQQISQGQVEQSSGELKIEAQPGVQNLTIQSALIPQIQ
QLQQNSLQQSIANQVNNTQQLQQSIIQQTLSPQALQLPNQSDNSQASTAVVASNIEYVVI
FIKNFMEKEISTSESNEISQALKNIEISIKQVIEKVQNELKGSAPKLEFYVQYNAQKKNF
WSHLFGVGTADVFQNIFEITSKLLKQTYPSCEVSFKQKKKQQEPSAKHLICFGVRPTITH
EKIKQWLEDQIFSSLTVSSISFNLVKKKESSTSTQSSKNFEKDSQVLYIFFLNEQEGIQF
MEICKKNLAHTNNIFYKPKISQYLTDKQRQDLKAKMNQNNSNNLGSQGYSSNHQNYQNHH
YQQGNSNNHHQVYHHNNGNNNNHNYNHNHHHHHNYNQNNHYNPNQHHYYTNNNNQNQTSN
HNHHHHHHHNNINNTAYHNNNPSYHNKNQQHSQQGNSHSHNHYQAGNHHFHQANFNQSHN
SNHHNGNNSHHSQHSQHPNHQSGYNNQNQAGQQSRQRNSKSMNYRTNQAGNNSSTNYQGG
QNYLGTNGQNNASSSSSQQNQSNQTNQQQRGSQNISSSQQNNQYNYGQGNSQNNQMQQRN
TAYAQHRSQINNQNNSQQSVHQGTKNIPSNYTQHHQKNQGMQNENTRNNRTRNQNNQHSM
NSNHHSHIANSQQGNNNQNNYHNNSQSYASSGNSFLPNYANNHQRIDQYSQSANIHNSNN
NRRSQNNNVNSSNLSSGNNNNFDNNNNKQNFTNSKSETNNSYTSTSSQGTAQIYVQKNQQ
NSNNSNGNKHFNGSSSGLNNSYSSFTSPPQGNRVNNANNTQGGTLNTFDTFPSNHITQNT
NSFGNIGRGTNSSNFHNTNSSTNQTVAQQQNYSNNTNNQQYFQANSNKNQNYFSPLGVNS
QSQQQNQVGQANGSIQNKSTNYLVNISSNNLIVNPNNSTANTTATASPTTASSQNVVNSM
SSNAFTSSLSSYIIALSNANTQQVQQNVIENLRNEVLNNKVEFKALQDKDLKNKTISYII
KQMIINLSSAEEKVGQLLQIKESDKIKAKVEHFISINEQICQLFTNCVFSTDEILQIIED
QNQLVQKCEYFTKLKTS