Identifiers and Description

Gene Model Identifier

TTHERM_00142290

Standard Name

RNH2 (RNase H2)

Aliases

PreTt26635 | 11.m00332 | 3702.m00056

Description

RNH2 ribonuclease HII protein; ribonuclease HII family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD02831 ) Macronucleus: neo3 KO of RNH2

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04848.1 9.003703520551527e-172
Description: ribonuclease HII family protein (285 aa)
DictyBase DDB_G0292584 6.9991332754409754e-68
Description: rnaseh2A on chromosome: 6 position 1802425 to 1803401
Oxytricha Contig14329.0.g31 3.0000115468388957e-66
Description: Ribonuclease HII
WormBase WBGene00004383 9.996907204735647e-62
Description: locus:rnh-2 Ribonuclease H2 subunit A status:Confirmed UniProt:Q9U6P6 protein_id:CAC70103.1
SGD YNL072W 2.0006622580855403e-35
Description: RNH201 Ribonuclease H2 catalytic subunit, removes RNA primers during Okazaki fragment synthesis and errant ribonucleotides misincorporated during DNA replication; homolog of RNAse HI; related to human AGS4 which causes Aicardi-Goutieres syndrome
Stentor Coeruleus SteCoe_28482 9.602680054508676e-24
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00142290(coding)
ATGGCAACATTTGAGAATAAAAAGAAAAATTTAGATTGGGTCATGGGTATAGATGAAGCA
GGAAGAGGACCTGTATTGGGACCTATGGTATATGGCTGTTGCGTTTGGCCAATTTAATAT
GAGCCTGAATTAAAATTAGAAGGCTTTAATGATTCAAAATAACTCACAGAATAGAAAAGA
GACTAGCTTTATGCACGTATGGAAGAATTAAAAAACGACAAGCTATATTTTGAAGTAAGA
ATTTTATCAGCAGAATTCTTATCTAACAGAATGTTAGCGAAAAATAGAGATTCTTTAAAT
GAGTTATCATTTAATGCTGCATATAGCTTGATAGATTCAGTAATGAGTTAAGGTTTTAAT
GTGACTTAAGTATTTTTAGACACAGTAGGTAAAGAAGAAACATATCAAGCAAAGCTCTAC
CAAGATTATAAATATACTTATCCATAACTTAAATTTACAGTATCTTCAAAAGCAGATGCT
AAATTTCCAGTTGTTGGAGCAGCATCAATTTGTGCTAAAGTTACAAGAGATCTTTAAATA
ACAAATAATGATATGAGAGAGCCTTTGGATCTATCTAAAGCTACAGGAAGCGGGTATCCA
TCTGATCCAAACACTAAAAAGTGGCTGTAAGAGGTATTTGACCCTGTATTTGGATTTCCA
TCTAATGTTAGATACTCGTGGTCAACAGTAGATAATATTTTTAATGAAAAAAAATTGTAA
GTAAACTTTTTTGATGAAAGTGATAAGAAAGATAAAAATTAAAAAAGCCTTACTTAAATG
GTAAGTTAAAAAAAATCTGAGACTAATGGATATTACTCAAAAAAAATAGGAATAACTAGA
AATTTTGATTTATGA


>TTHERM_00142290(gene)
ATGGCAACATTTGAGAATAAAAAGAAAAATTTAGATTGGGTCATGGGTATAGATGAAGCA
GGAAGAGGACCTGTATTGGGACCTATGGTATATGGCTGTTGCGTTTGGCCAATTTAATAT
GAGCCTGAATTAAAATTAGAAGGCTTTAATGATTCAAAATAACTCACAGAATAGAAAAGA
GACTAGCTTTATGCACGTATGGAAGAATTAAAAAACGACAAGCTATATTTTGAAGTAAGA
ATTTTATCAGCAGAATTCTTATCTAACAGAATGTTAGCGAAAAATAGAGATTCTTTAAAT
GAGTTATCATTTAATGCTGCATATAGCTTGATAGATTCAGTAATGAGTTAAGGTTTTAAT
GTGACTTAAGTATTTTTAGACACAGTAGGTAAAGAAGAAACATATCAAGCAAAGCTCTAC
CAAGATTATAAATATACTTATCCATAACTTAAATTTACAGTATCTTCAAAAGCAGATGCT
AAATTTCCAGTTGTTGGAGCAGCATCAATTTGTGCTAAAGTTACAAGAGATCTTTAAATA
ACAAATAATGATATGAGAGAGCCTTTGGATCTATCTAAAGCTACAGGAAGCGGGTATCCA
TCTGATCCAAACACTAAAAAGTGGCTGTAAGAGGTATTTGACCCTGTATTTGGATTTCCA
TCTAATGTTAGATACTCGTGGTCAACAGTAGATAATATTTTTAATGAAAAAAAATTGTAA
GTAAACTTTTTTGATGAAAGTGATAAGAAAGATAAAAATTAAAAAAGCCTTACTTAAATG
GTAAGTTAAAAAAAATCTGAGACTAATGGATATTACTCAAAAAAAATAGGAATAACTAGA
AATTTTGATTTATGA


>TTHERM_00142290(protein)
MATFENKKKNLDWVMGIDEAGRGPVLGPMVYGCCVWPIQYEPELKLEGFNDSKQLTEQKR
DQLYARMEELKNDKLYFEVRILSAEFLSNRMLAKNRDSLNELSFNAAYSLIDSVMSQGFN
VTQVFLDTVGKEETYQAKLYQDYKYTYPQLKFTVSSKADAKFPVVGAASICAKVTRDLQI
TNNDMREPLDLSKATGSGYPSDPNTKKWLQEVFDPVFGFPSNVRYSWSTVDNIFNEKKLQ
VNFFDESDKKDKNQKSLTQMVSQKKSETNGYYSKKIGITRNFDL