Identifiers and Description

Gene Model Identifier

TTHERM_00143570

Standard Name

TGL10 (TriGlyceride Lipase)

Aliases

PreTt26664 | 11.m00361 | 3702.m00084

Description

TGL10 ab-hydrolase associated lipase region family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region
  • ( PF05448 ) Acetyl xylan esterase (AXE1)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04814.1 9.997093137033517e-262
Description: ab-hydrolase associated lipase region family protein (381 aa)
Oxytricha Contig11487.0.g49 3.0013534825799953e-36
Description: Partial alpha/beta-hydrolase lipase region
WormBase WBGene00021963 4.999350823993609e-33
Description: locus:lipl-6 status:Partially_confirmed UniProt:E2S7J2 protein_id:CCD72909.1
DictyBase DDB_G0276083 2.0009605191578312e-25
Description: lip4 on chromosome: 2 position 6415536 to 6416900
SGD YKL140W 1.999598840915195e-17
Description: TGL1 Steryl ester hydrolase, one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes
Stentor Coeruleus SteCoe_6069 0.0000000000018795288165390832
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00143570(coding)
ATGAGCTATATCAAAAAATCAGTAAAAGGAATTTTGATTTCTATATTTTTCTATCTGATG
TTCATTTATGAAAGCGAAGAAGAGCTTTTTTGGAAGAAGCCTATCGATGAGAGGCTCAGG
CTTTAGCTTTATCCTGTAGAACGTCACTACATATTGACAGAAGATAAATTCAACATAACT
CTCTTTAGGGTTGGTAAGAAAGGATTAAGTTAAGTTAGTACCAGAGGTAAACCTGTTATA
TTCGTGCCTCAATTTCTGAACTGCATAGATACATATGTGTCAAATGAGGATCATCTAGCG
CCAGCACTTGTATTTGCTAATCAGGGATTTGATGTATGGTTGATGAGCCAAAGAGGTGGA
GAGTATTCTCCAAATGAAGATAGATAAGATGGGTTTTCTTTTCATGAAATAGGATATTTT
GACCTTCCTAAATCATATGAATATATTTATTCACTTAATCCTTAAAATATAACAGCAGTT
GGGCATTCATAAGGAGGCAATACAATTTTTGTCTCATTGACTGAGAAAAGATTAAAAAAT
GTACATAAAATAATAATGTTTGCTCCTGGCCCTTTTGCCAAGAATGCTACAGGCTTGATT
CCATATTTTGTAAGCTCTCGTTTTGTGGATATTTTAGCTAAATACACCGATAGAATAAAC
CTTACTCCCAGTAAGTATCTATTTAAGCTTTGCAAATACTTCCATCTTCCCTCTAAACTA
TTTTTAACTACAGTAACTGACACATGGGAAAGTGATATGAATATAGCAAAGCTATATTAA
TACACAAAGCATTCCCCATAGCCCTAATCAATAAAAAATCTTTTACATTTAAAATAATTA
TTGATAAAAGGTTAATTTTATAAATATGATTATGGCTAAGAGTAAAATTTGAAAATCTAT
GGTTAAGAAGAAGCTCCTCTTTATGATTTGCTTTCAATCACAGAAAGTATTCATCTATTT
TATGGTCCTCATGATATATTAACTAGGTATCCAGATAATATTGAGCTTTATGAAATTTTG
AAAAAAAGCTAAGCAAAAAACGTTACTTTTAGTTATTATCCTACCGTAGGTCACGTTAGT
TTTATATTAGATTCAAAAGCTGAGTTTTTATAAGAAATGATTAAGATAATTGAAGAAGAT
TGA


>TTHERM_00143570(gene)
ATGAGCTATATCAAAAAATCAGTAAAAGGAATTTTGATTTCTATATTTTTCTATCTGATG
TTCATTTATGAAAGCGAAGAAGAGCTTTTTTGGAAGAAGCCTATCGATGAGAGGCTCAGG
CTTTAGCTTTATCCTGTAGAACGTCACTACATATTGACAGAAGATAAATTCAACATAACT
CTCTTTAGGGTTGGTAAGAAAGGATTAAGTTAAGTTAGTACCAGAGGTAAACCTGTTATA
TTCGTGCCTCAATTTCTGAACTGCATAGATACATATGTGTCAAATGAGGATCATCTAGCG
CCAGCACTTGTATTTGCTAATCAGGGATTTGATGTATGGTTGATGAGCCAAAGAGGTGGA
GAGTATTCTCCAAATGAAGATAGATAAGATGGGTTTTCTTTTCATGAAATAGGATATTTT
GACCTTCCTAAATCATATGAATATATTTATTCACTTAATCCTTAAAATATAACAGCAGTT
GGGCATTCATAAGGAGGCAATACAATTTTTGTCTCATTGACTGAGAAAAGATTAAAAAAT
GTACATAAAATAATAATGTTTGCTCCTGGCCCTTTTGCCAAGAATGCTACAGGCTTGATT
CCATATTTTGTAAGCTCTCGTTTTGTGGATATTTTAGCTAAATACACCGATAGAATAAAC
CTTACTCCCAGTAAGTATCTATTTAAGCTTTGCAAATACTTCCATCTTCCCTCTAAACTA
TTTTTAACTACAGTAACTGACACATGGGAAAGTGATATGAATATAGCAAAGCTATATTAA
TACACAAAGCATTCCCCATAGCCCTAATCAATAAAAAATCTTTTACATTTAAAATAATTA
TTGATAAAAGGTTAATTTTATAAATATGATTATGGCTAAGAGTAAAATTTGAAAATCTAT
GGTTAAGAAGAAGCTCCTCTTTATGATTTGCTTTCAATCACAGAAAGTATTCATCTATTT
TATGGTCCTCATGATATATTAACTAGGTATCCAGATAATATTGAGCTTTATGAAATTTTG
AAAAAAAGCTAAGCAAAAAACGTTACTTTTAGTTATTATCCTACCGTAGGTCACGTTAGT
TTTATATTAGATTCAAAAGCTGAGTTTTTATAAGAAATGATTAAGATAATTGAAGAAGAT
TGA


>TTHERM_00143570(protein)
MSYIKKSVKGILISIFFYLMFIYESEEELFWKKPIDERLRLQLYPVERHYILTEDKFNIT
LFRVGKKGLSQVSTRGKPVIFVPQFLNCIDTYVSNEDHLAPALVFANQGFDVWLMSQRGG
EYSPNEDRQDGFSFHEIGYFDLPKSYEYIYSLNPQNITAVGHSQGGNTIFVSLTEKRLKN
VHKIIMFAPGPFAKNATGLIPYFVSSRFVDILAKYTDRINLTPSKYLFKLCKYFHLPSKL
FLTTVTDTWESDMNIAKLYQYTKHSPQPQSIKNLLHLKQLLIKGQFYKYDYGQEQNLKIY
GQEEAPLYDLLSITESIHLFYGPHDILTRYPDNIELYEILKKSQAKNVTFSYYPTVGHVS
FILDSKAEFLQEMIKIIEED