Identifiers and Description

Gene Model Identifier

TTHERM_00143660

Standard Name

HTA3 (Histone h Two A 3 )

Aliases

histone H2A var hv1 | hv1 | H2A.Z | PreTt26673 | 11.m00370 | 3702.m00093

Description

HTA3 histone H2A; Histone H2A (variant H2A.Z); essential protein; regulated by acetylation- which modulates charge patch on its N-terminal tail; comprises about 20% of total H2A protein in Tetrahymena; found only in transcriptionally active nuclei

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

External Links

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • positive regulation of DNA-templated transcription (IEP) | GO:0045893

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and archaeal histone

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

  • ( SD02070 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K7R,K10R,K13R, K21R.
  • ( SD02071 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K7R,K10R,K16R, K21R.
  • ( SD02072 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations Del4-24 aa.
  • ( SD02073 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7Q,K10Q,K13Q,K16Q,K21R
  • ( SD02074 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7R,K10Q,K13Q,K16Q,K21Q
  • ( SD02075 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K7R,K10R,K13R,K16R,K21R
  • ( SD02076 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K10R,K13R,K16R,K21R
  • ( SD02454 ) Macronucleus: GFP tagged HTAZ
  • ( SD02455 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7R,K10Q,K13Q,K16Q,K21Q
  • ( SD02456 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R, K7R,K10R,K13R,K16R.
  • ( SD02457 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutation K130R
  • ( SD02458 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutation K130R
  • ( SD02462 ) Macronucleus: inserted HTAZ with K4R Into MTT1 locus and neo2 in 5’ flanking of MTT1
  • ( SD02463 ) Macronucleus: inserted HTAZ with K4R,K7R,K10R,K13R K16R, K21R Into MTT1 locus and neo2 in 5’ flanking of MTT1
  • ( SD02464 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R, K7R,K10R,K13R,K16R,K21R,K23Q, K24Q
  • ( SD02465 ) Micronucleus: Neo2 in HTAZ Macronucleus: H2A.Z with a major H2A.1 n-terminal tail, S1V and 5R mutations.
  • ( SD02672 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02673 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02674 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02675 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02684 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02685 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding,
  • ( SD02686 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02687 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02688 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02689 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02690 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02691 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02874 ) Macronucleus: neo2 into HTA3
  • ( SD02875 ) Macronucleus: neo2 into HTA3

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04805.1 3.000935899181433e-99
Description: core histone H2A/H2B/H3/H4 family protein (147 aa)
Oxytricha Contig16838.0.g30 3.0014802379878627e-60
Description: Core histone H2A/H2B/H3/H4
WormBase WBGene00019947 5.002488024924283e-58
Description: locus:htz-1 Histone H2A.V status:Confirmed UniProt:Q27511 protein_id:CCD73086.1
SGD YOL012C 8.000462645699572e-47
Description: HTZ1 Histone variant H2AZ, exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin
DictyBase DDB_G0286747 1.0004783691736523e-35
Description: H2AZ on chromosome: 4 position 4922308 to 4922992
Stentor Coeruleus SteCoe_35065 3.221340285992516e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):
  2. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  3. Ref:11430834: Ren Q, Gorovsky MA (2001) Histone H2A.Z acetylation modulates an essential charge patch. Molecular cell 7(6):1329-35
  4. Ref:8754831: Liu X, Li B, GorovskyMA (1996) Essential and nonessential histone H2A variants in Tetrahymena thermophila. Molecular and cellular biology 16(8):4305-11
  5. Ref:8276246: Stargell LA, Bowen J, Dadd CA, Dedon PC, Davis M, Cook RG, Allis CD, Gorovsky MA (1993) Temporal and spatial association of histone H2A variant hv1 with transcriptionally competent chromatin during nuclear development in Tetrahymena thermophila. Genes & development 7(12B):2641-51
  6. Ref:3211129: White EM, Gorovsky MA (1988) Localization and expression of mRNA for a macronuclear-specific histone H2A variant (hv1) during the cell cycle and conjugation of Tetrahymena thermophila. Molecular and cellular biology 8(11):4780-6
  7. Ref:3340523: White EM, Shapiro DL, Allis CD, Gorovsky MA (1988) Sequence and properties of the message encoding Tetrahymena hv1, a highly evolutionarily conserved histone H2A variant that is associated with active genes. Nucleic acids research 16(1):179-98
  8. Ref:3944120: Allis CD, Richman R, Gorovsky MA, Ziegler YS, Touchstone B, Bradley WA, Cook RG (1986) hv1 is an evolutionarily conserved H2A variant that is preferentially associated with active genes. The Journal of biological chemistry 261(4):1941-8
  9. Ref:6692982: Allis CD, Wiggins JC (1984) Histone rearrangements accompany nuclear differentiation and dedifferentiation in Tetrahymena. Developmental biology 101(2):282-94
  10. Ref:6373790: Wenkert D, Allis CD (1984) Timing of the appearance of macronuclear-specific histone variant hv1 and gene expression in developing new macronuclei of Tetrahymena thermophila. The Journal of cell biology 98(6):2107-17

Sequences

>TTHERM_00143660(coding)
ATGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAGGC
GCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAATTCCCAGTC
GGTAGAATCCACAGATTTTTGAAGGGTAGAGTTAGTGCTAAGAACAGAGTTGGTGCTACT
GCTGCTGTTTATGCTGCTGCTATTTTGGAATATTTAACAGCAGAAGTTTTGGAATTGGCT
GGTAATGCTTCTAAGGATTTCAAAGTCAGAAGAATCACTCCTCGTCACTTGCTCTTGGCT
ATTAGAGGTGATGAAGAATTAGATATTTTGATCAAGGCTACCATTGCTGGTGGTGGTGTC
ATTCCTCACATCCATAAAGCTCTCTTGGGTAAGCACTCTACTAAAAACAGATCTAGTGCT
AAGACTGCTGAACCTCGTTGA


>TTHERM_00143660(gene)
ATGGTAATTTAAATTTTTTTTAGAGTGGCTTAATCTCATTTTTAATCAATTTTCAAATAA
AATAGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAG
GCGCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAAGTAATAT
TGGCATCAGGATGTCCATCATTCTGAGCATTTGACTCAGTTGTGATTTTATTAACGCTAA
AATATTATAATAATAAAGTTCCCAGTCGGTAGAATCCACAGATTTTTGAAGGGTAGAGTT
AGTGCTAAGAACAGAGTTGGTGCTACTGCTGCTGTTTATGCTGCTGCTATTTTGGAATAT
TTAACAGCAGAAGTTTTGGAATTGGCTGGTAATGCTTCTAAGGATTTCAAAGTCAGAAGA
ATCACTCCTCGTCACTTGCTCTTGGCTATTAGAGGTGATGAAGAATTAGATATTTTGATC
AAGGCTACCATTGCTGGTGGTGGTGTCATTCCTCACATCCATAAAGCTCTCTTGGGTAAG
CACTCTACTAAAAACAGATCTAGTGCTAAGACTGCTGAACCTCGTTGA


>TTHERM_00143660(protein)
MAGGKGGKGGKGGKGGKVGGAKNKKTPQSRSYKAGLQFPVGRIHRFLKGRVSAKNRVGAT
AAVYAAAILEYLTAEVLELAGNASKDFKVRRITPRHLLLAIRGDEELDILIKATIAGGGV
IPHIHKALLGKHSTKNRSSAKTAEPR