Identifiers and Description

Gene Model Identifier

TTHERM_00144930

Standard Name

MRNN01 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt26701 | 11.m00398 | 3702.m00120

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04770.1 5.9988120619233335e-177
Description: protein kinase domain-containing protein (1224 aa)
Oxytricha Contig1226.1.g111 0.00000000000001000191320216021
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00144930(coding)
ATGAAGCCTTAAACATCTCATAGCTCTGAAAAATTAAAAAAAATTATGTAACCAAAATAC
TAAGTAAACTTACACCAAAAGAGCTAAACTTAAATTTATAATCCATCTAGCTTATAAATT
TAACCTCTGAGCTAAATGCTTAACCTTAATTTAAAAAAATAAATAACAGATAAGCATCAA
GTCAGTTCGAATTACAGCTCTTAGAATTAATTTATGTAAATATTTTAACAGGTCAGTGAA
AACAAAAACTAGAAGATAGACCAAAATAGTATATCTCAACAAAAAAAATATACTTAATTT
ATTAAAAAAAATTACTAAAATGGTATTTACTTTGGGCAAATGAATTGTAACACACCTGAT
GGAGAAGGTGGTTTCTTTTGGGATAATGGTTGCTTTTACTATGGTTAGTGGAAAAATGGA
TTGATGCATGGCTGTGGTCTATTTATTTTTAAGACAGGCAGCGTTTTAAGAGGGAACTTC
AAGAAAGGTTAAGCTAATGGATTAGCAGAGCTCTCTTTTTTTCCATCGTTCTAATAATAG
ATTTTAAATGGTTTTTGGATTGATGGATAGTTTGAAGGCTCATCACCAGCTCAGTTTTAT
AAAAATGGGTTTAATTAAGTAACTAACTTTGATGAAAAAAATTAAAGTGAAGGAAAGAAA
CTGTAAGTTGCTTTTTTTTCAGATAAAATTGAAAGCAAATAGAAAGATAATTCATAAAGT
TAATTCGAAATTAATCCTTATTATTATGATGCTGAGTTAAAAAAAAGACTAGAAAATTAT
ATTGCTTGCGAGAACAGTATAGAAGTTGGTGAAAGAAAAAGTAATTTGCTAAATGGTCTA
GCTATTAGATTCCACTTTGATGGAAAAATTGAATTTGGAAGTTTTAAAAAAGGATTACTT
GAAGGAAGAGGCAAAATAATTTTCAAAACAGGAGACATTTATGATGGATATTTTATTAAT
TCTATATTTTAAGGTCCAGGAGTTTACTATAACAACTAAGATAAGGTGTGGGCTTACGGT
GCATTTTCTAAAAACAAAATAATGTATTTGCAGCAATAAAATACTTCATATCCTCCTCCA
GCTTTATATGACCTACGTGAAAAAGACGAATATGTTGATTCTAGTGATAGATTAATTGGC
GAAAACTAACTTAGAGATAGAAATATTGTCCTGGACACTGTTCTAGTAGAAGATATTCAA
AAAAGGGCTAACGGTGAAGTAATATAACATTAAACTCGTACAAACTAAACAACACAAGCA
GATTAAACTGAAGAAGAATTAGATGCAGGAGTTCGCTAATATTCTTAAATTTCACCATTT
TCAGGTGCTGTAGAATAAAACAAGATGAGTTCTTACTATAATCCAGAGTTTGTAAATTAA
GCAGGTCTAAGAAAAACTGCAGATTTTGGAAACACAATTAAAAATTTATCAAGCATATTT
TAAGCTTCACCAAACAATCTTTAAGAGGATACTATTAATAGAGACTAAGAATTAATAAAT
ACAAGCCACGATAAAGTTAGAAAATCTATTGAAGAAAAGATAATAGAAAAGCAACTTGAG
AGTGATAATGAAGCCAATAATTAAAATTCAAATTAGTCACATCCTTCTTAATAACTAGAA
ACTCATCAAACAGTCATTTAATTTTCTCCAAAAAGCTAAAACTATTTAACTTCAAGAAAC
AAAACAGCTAATAATTTGGAAAATAATTTAACTCATGATAACCTTGAATTCCCATGTGAA
TTCACTCAAAAATATTATTATGGTATAAGTGAAGAGACATATTAAATCATTTAAGAACTT
GAAAAGAAAGAAATTATTTAGAAAAAACGAGAAAAATCTTTAGAAAAAATTAGCTAAATA
AAGGCTTTGATTACAAATTATTTGAGTTAACCATAAAATTTATTGGTTTCTACACCGAAT
AACAAAAAATCTTTATAAAGAAATTAATAAACAAATATTGATAAATAAAACTCTCTGAAT
AAAACAACTACAAGAAGTAATAATGAAAATATAAATCCTTAAATTAAAAGAAATCCTAGC
TCTGTATCTTCTTATTCTACTCGAAATTAGTTTTCTGGAGTTCTAAGTAGTTAAAAACCT
AAAAGTAACTATTAAAATAGAGAATAACCAAGAAAAATTTAAACTTTTGAAGATTAAAGT
ATTTCAAGCAGAAATATGCAAGGAAAGAATAATTCAATTAAAAATAATAATCATGTTTAG
ATCCAAAATGAAATCACAAGTAGATAAAATTCCTAAAAAGTGAACAATAACTTCATTGGA
AATCAAACTTTTTAGAATATTTATAAAAATAATGAACTATTTTAACCCTTTCAAATTTAA
GATATAAATAATACATAAAATAAATGTAGCTTCAATGAAAAATAGAAACATAATTTTTAA
GCTAATCCTGAAAAATAAAATAGAGTTTCTATAAATTCTTCTAAATCAAATTCACAAGTT
TAGTAGAGCTCTCCAAACTAGTTTAAAAAAATTTAGTAAAGGATAAAAAACTTTTCTCAG
TAATATGAAGCATAAAATTAAATAAATTATCAACAAGGCAATAAGAATAAGTAGAATATT
ATTTTTAAGAATTTTGAGCATATACAAAGTGAAAATACTCCTATATCCTCTCCACATAAT
TATTAGGCAAATTTAAATCCTTAGAATTAACAAAGTACCAAAAACAATCATCCTAATGAA
CCCTAAAAATAGTTTTTCTTTACATAATCATGCCGTAATCATAAAAGACATGTCTCTTCT
ATTAGCTTTAGCTCTAATAATTAAGTAGGAAATACCTAAATATAACCAAAAAGATCTCAA
TATCCGTTAAGTATTTAAATATACTGA


>TTHERM_00144930(gene)
ATGAAGCCTTAAACATCTCATAGCTCTGAAAAATTAAAAAAAATTATGTAACCAAAATAC
TAAGTAAACTTACACCAAAAGAGCTAAACTTAAATTTGTAATTTTACATACTACATTAGT
AAATTTTAGAGTAATAAATAATTAACGATATAAAAATAGATAATCCATCTAGCTTATAAA
TTTAACCTCTGAGCTAAATGCTTAACCTTAATTTAAAAAAATAAATAACAGATAAGCATC
AAGTCAGTTCGAATTACAGCTCTTAGAATTAATTTATGTAAATATTTTAACAGGTCAGTG
AAAACAAAAACTAGAAGATAGACCAAAATAGTATATCTCAACAAAAAAAATATACTTAAT
TTATTAAAAAAAATTACTAAAATGGTATTTACTTTGGGCAAATGAATTGTAACACACCTG
ATGGAGTATATTAATTTATATATTTTATCTTTTATCGTCAATGATCTTTTAATTTATGTA
GGAAGGTGGTTTCTTTTGGGATAATGGTTGCTTTTACTATGGTATATAAAAATATTTTAA
ATAACTAAGTATATAAAAAATAAACACTCATTCATTTAAAATAGGTTAGTGGAAAAATGG
ATTGATGCATGGCTGTGGTCTATTTATTTTTAAGACAGGCAGCGTTTTAAGAGGGAACTT
CAAGAAAGGTTAAGCTAATGGATTAGCAGAGCTCTCTTTTTTTCCATCGTTCTAATAATA
GATTTTAAATGGTTTTTGGATTGATGGATAGTTTGAAGGCTCATCACCAGCTCAGTTTTA
TAAAAATGGGTTTAATTAAGTAACTAACTTTGATGAAAAAAATTAAAGTGAAGGAAAGAA
ACTGTAAGTTGCTTTTTTTTCAGATAAAATTGAAAGCAAATAGAAAGATAATTCATAAAG
TTAATTCGAAATTAATCCTTATTATTATGTAATTAATATTTCAAAAAAGGATTACTCTTT
TTTTAACAAAAATCTATTTATAAAAAGGATGCTGAGTTAAAAAAAAGACTAGAAAATTAT
ATTGCTTGCGAGAACAGTATAGAAGTTGGTGAAAGAAAAAGTAATTTGCTAAATGGTCTA
GCTATTAGATTCCACTTTGATGGAAAAATTGAATTTGGAAGTTTTAAAGTAGGTTTTTTT
GATATTAATTTTATTTTAAATAAAAGAATTTTTCTATTTAATTAGAAAGGATTACTTGAA
GGAAGAGGCAAAATAATTTTCAAAACAGGAGACATTTATGATGGATATTTTATTAATTCT
ATATTTTAAGGTCCAGGTATGAAATATTATTATTTTATGCTCTATCTATATTTATTCTTT
GTGAATATTAAATAGGAGTTTACTATAACAACTAAGATAAGGTGTGGGCTTACGGTGCAT
TTTCTAAAAACAAAATAATGTATTTGCAGCAATAAAATACTTCATATCCTCCTCCAGCTT
TATGTAAAATATTACATATTAATTCGTATATTAAATTCTGATTTCTAACAAAAGATGACC
TACGTGAAAAAGACGAATATGTTGATTCTAGTGATAGATTAATTGGCGAAAACTAACTTA
GAGATAGAAATATTGTCCTGGACACTGTTCTAGTAGAAGATATTCAAAAAAGGGCTAACG
GTGAAGTAATATAACATTAAACTCGTACAAACTAAACAACACAAGCAGATTAAACTGAAG
AAGAATTAGATGCAGGAGTTCGCTAATATTCTTAAATTTCACCATTTTCAGGTGCTGTAG
AATAAAACAAGATGAGTTCTTACTATAATCCAGAGTTTGTAAATTAAGCAGGTCTAAGAA
AAACTGCAGATTTTGGAAACACAATTAAAAATTTATCAAGCATATTTTAAGCTTCACCAA
ACAATCTTTAAGAGGATACTATTAATAGAGACTAAGAATTAATAAATACAAGCCACGATA
AAGTTAGAAAATCTATTGAAGAAAAGATAATAGAAAAGCAACTTGAGAGTGATAATGAAG
CCAATAATTAAAATTCAAATTAGTCACATCCTTCTTAATAACTAGAAACTCATCAAACAG
TCATTTAATTTTCTCCAAAAAGCTAAAACTATTTAACTTCAAGAAACAAAACAGCTAATA
ATTTGGAAAATAATTTAACTCATGATAACCTTGAATTCCCATGTGAATTCACTCAAAAAT
ATTATTATGGTATAAGTGAAGAGACATATTAAATCATTTAAGAACTTGAAAAGAAAGAAA
TTATTTAGAAAAAACGAGAAGTAAAAATTTATTTTTTCATTTTTAATTTTTATTTTTGAA
TTTGTCTTTCTTTCATTATTTGTATTTTATTAAGTTTAAAGAAAAAAGAAATTATTATTT
TAAAATATTTTTGAAAATTTGAAATAGAAATCTTTAGAAAAAATTAGCTAAATAAAGGCT
TTGATTACAAATTATTTGAGTTAACCATAAAATTTATTGGTTTCTACACCGAATAACAAA
AAATCTTTATAAAGAAATTAATAAACAAATATTGATAAATAAAACTCTCTGAATAAAACA
ACTACAAGAAGTAATAATGAAAATATAAATCCTTAAATTAAAAGAAATCCTAGCTCTGTA
TCTTCTTATTCTACTCGAAATTAGTTTTCTGGAGTTCTAAGTAGTTAAAAACCTAAAAGT
AACTATTAAAATAGAGAATAACCAAGAAAAATTTAAACTTTTGAAGATTAAAGTATTTCA
AGCAGAAATATGCAAGGAAAGAATAATTCAATTAAAAATAATAATCATGTTTAGATCCAA
AATGAAATCACAAGTAGATAAAATTCCTAAAAAGTGAACAATAACTTCATTGGAAATCAA
ACTTTTTAGAATATTTATAAAAATAATGAACTATTTTAACCCTTTCAAATTTAAGATATA
AATAATACATAAAATAAATGTAGCTTCAATGAAAAATAGAAACATAATTTTTAAGCTAAT
CCTGAAAAATAAAATAGAGTTTCTATAAATTCTTCTAAATCAAATTCACAAGTTTAGTAG
AGCTCTCCAAACTAGTTTAAAAAAATTTAGTAAAGGATAAAAAACTTTTCTCAGTAATAT
GAAGCATAAAATTAAATAAATTATCAACAAGGCAATAAGAATAAGTAGAATATTATTTTT
AAGAATTTTGAGCATATACAAAGTGAAAATACTCCTATATCCTCTCCACATAATTATTAG
GCAAATTTAAATCCTTAGAATTAACAAAGTACCAAAAACAATCATCCTAATGAACCCTAA
AAATAGTTTTTCTTTACATAATCGTAAGTGATTTTAATTTTTAATTTTATTCAAAGTAAA
ATTTATGAGAATTAAATTTTATTGATGTAAGGTTTATTAGTAGACTAATAAGCCAACATT
AAACATTTAGCATTCCAAGCAGTATAAATAATTCAAAATATTTAAAATTATTTTCAGAAA
TAAATATTTTTGAAACCACATTTAAACTTTATTATTTGATTCTAAAATTTATTTTATTAT
TTATTAAAAAAGATGCCGTAATCATAAAAGACATGTCTCTTCTATTAGCTTTAGCTCTAA
TAATTAAGTAGGAAATACCTAAATATAACCAAAAAGATCTCAATATCCGTTAAGTATTTA
AATATACTGA


>TTHERM_00144930(protein)
MKPQTSHSSEKLKKIMQPKYQVNLHQKSQTQIYNPSSLQIQPLSQMLNLNLKKQITDKHQ
VSSNYSSQNQFMQIFQQVSENKNQKIDQNSISQQKKYTQFIKKNYQNGIYFGQMNCNTPD
GEGGFFWDNGCFYYGQWKNGLMHGCGLFIFKTGSVLRGNFKKGQANGLAELSFFPSFQQQ
ILNGFWIDGQFEGSSPAQFYKNGFNQVTNFDEKNQSEGKKLQVAFFSDKIESKQKDNSQS
QFEINPYYYDAELKKRLENYIACENSIEVGERKSNLLNGLAIRFHFDGKIEFGSFKKGLL
EGRGKIIFKTGDIYDGYFINSIFQGPGVYYNNQDKVWAYGAFSKNKIMYLQQQNTSYPPP
ALYDLREKDEYVDSSDRLIGENQLRDRNIVLDTVLVEDIQKRANGEVIQHQTRTNQTTQA
DQTEEELDAGVRQYSQISPFSGAVEQNKMSSYYNPEFVNQAGLRKTADFGNTIKNLSSIF
QASPNNLQEDTINRDQELINTSHDKVRKSIEEKIIEKQLESDNEANNQNSNQSHPSQQLE
THQTVIQFSPKSQNYLTSRNKTANNLENNLTHDNLEFPCEFTQKYYYGISEETYQIIQEL
EKKEIIQKKREKSLEKISQIKALITNYLSQPQNLLVSTPNNKKSLQRNQQTNIDKQNSLN
KTTTRSNNENINPQIKRNPSSVSSYSTRNQFSGVLSSQKPKSNYQNREQPRKIQTFEDQS
ISSRNMQGKNNSIKNNNHVQIQNEITSRQNSQKVNNNFIGNQTFQNIYKNNELFQPFQIQ
DINNTQNKCSFNEKQKHNFQANPEKQNRVSINSSKSNSQVQQSSPNQFKKIQQRIKNFSQ
QYEAQNQINYQQGNKNKQNIIFKNFEHIQSENTPISSPHNYQANLNPQNQQSTKNNHPNE
PQKQFFFTQSCRNHKRHVSSISFSSNNQVGNTQIQPKRSQYPLSIQIY