Identifiers and Description

Gene Model Identifier

TTHERM_00145990

Standard Name

PYK2 (PYruvate Kinase)

Aliases

PreTt26806 | 11.m00503 | 3702.m00225

Description

PYK2 pyruvate kinase complex alpha subunit; pyruvate kinase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • negative regulation of interleukin-1 beta secretion (IEA) | GO:0050713

Domains

  • ( PF00166 ) chaperonin GroS
  • ( PF00224 ) Pyruvate kinase, barrel domain
  • ( PF02887 ) Pyruvate kinase, alpha/beta domain
  • ( PF03328 ) HpcH/HpaI aldolase/citrate lyase family
  • ( TIGR01064 ) pyruvate kinase
  • ( TIGR01634 ) phage tail protein I

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04674.1 9.997093137033517e-262
Description: pyruvate kinase (497 aa)
Oxytricha Contig18083.0.g114 1.9994249217050915e-157
Description: Pyruvate kinase, barrel domain
DictyBase DDB_G0283247 6.999872280442742e-128
Description: pyk on chromosome: 4 position 344914 to 346711
WormBase WBGene00014001 1.000434858898539e-105
Description: locus:pyk-2 Pyruvate kinase status:Confirmed UniProt:D3YT36 protein_id:CBK19520.1
SGD YAL038W 4.999027844641202e-91
Description: CDC19 Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration
Stentor Coeruleus SteCoe_6611 5.301718666092324e-65
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00145990(coding)
ATGTCATAAATCCTAAGATACCAAGGCAAATTGATCTAATATAGGAAGATTTAATTTACT
ATTAAAAATTTGTAATACTTATATTAAAGTGAATGTTTAAAGATTACTATATCATAAAAT
ATTAATTAAGTAAATCTATATTACGTATACAGTGAATTATCTAAACAGATATAAACGCAA
AACTAAATATATATTTCAAAATAATTAAAAGTTATAGCAAATCATAACACTATTTTTAAG
ATAGCTAAGGCAGACCAAAGAATGAACACATTTGGATAAAATTTCAATTTAAATAAGGTT
TTAAAGGAAACTGATTACTCAAAAAGAAAAACCAAAATAGTTTGTACATTAGGCCCTTAA
AGCTCTAGTGTAGAAATGATATGCAAGCTTCTTGATTCAGGAATGAATGTTGCAAGAATT
ACTTATTGTCATGGATTAAAGCAATTTTATGAAACAGTAATTAGCAATTTGAAATAAGCA
TTCAAACTCAGAAAAAGCATTCAATGTTCTATTATGTTAGATACAAGGGGTCCAGATATT
AGAACTTCTTTACTAAAGGATAAAAAACCTATTGAAATAAAGAAAGGATAAAAATTAAAA
ATAATGGATGAGCAGCCAGAATATGAAGGAGATGAGTAAGGGATAGGTTGTTCTATAGCT
CTTTCAAAATTAGTTTAAGTTGGATAACATGTGTTATTATCAGATAATACAATATATTCT
CATGTTGTTGAAGTAAATGAGTCTGATATTGTTGTCTAGTTTGAAAATGAGGGAATTTTA
AACGAAGTAAAAAATGTAAGACTTCCAGGTGTTAAAATAGATTTGCCAACAATAAGTGAA
GAAGATGAAGATTTTATCATTTCATAAGGATTAGAAAAAGGTGTAGATTTTATAGCTGTA
TCTTTCGTACGTAGTGGGGAAGATATTGAATATGTAAGAGATCTTTTATCTCCTAGAGGG
GAGCATATTAAAATCATAGCAAAAATTGAAAATATAGAAGGTATGGAGAACTTTGAAGAT
ATTTTAAAAAGTTCTGATGGTATTATGGTAGCAAGAGGTGACTTAGGTATGGTCATCCCA
GCATAGAAAGTTTTCGTTGCCTAAAAATGGATGATAGATCGCTGTCTTGAAGTTGGTAAA
CCTGTAATTACTGCAACATAGATGATGGAAAGTATGGTAAAAAATCCAAGACCAACTAGA
GCTGAAGCTAGTGATGTAGCTAATGCAGTTTTAGATGGCACAGATGCTGTCATGCTATCT
ACAGAAACATCTGTAGGGTAATATCCTTGTGAATGTGTCGAAATTACCTCTTAAATTGCT
AGAGAAGCAGAAATGTGTTACAATAATGCAGACAACTTTTTCAAAAGAACAAAACTGATA
AGAGAAATTTCTGACACTGAGAGTATGGCAACTAGTGCAGTATAAATGAGTTTTGATTTA
AAAGCACCTATTATTGTTGTTTTTACAATGTATGGAGAGATGGCTAGATTAATATCTAAA
TATAGACCAACAGCTCACGTGATTGTTGTAAGCAATGAACCTGGAACAATCAAAGCTTTA
ACCTTAAGCCATGGCATTATTAGTCTCAAAGTTCCTTCGTTTTAAGGTATTGAAAAGCTT
ATAGATTATGCTATCAATCGTGCTAAAGAATTAAATTTATGTAAGAAGGGGAATAAAGTT
ATAGTCGTAATGGGAAGTGAAGAAGAGGATTAAGATTAAAGTGATATCTTAAAAGTAAAA
ACTGTGTCATGA


>TTHERM_00145990(gene)
ATGTCATAAATCCTAAGATACCAAGGCAAATTGATCTAATATAGGAAGATTTAATTTACT
ATTAAAAATTTGTAATACTTATATTAAAGTGAATGTTTAAAGATTACTATATCATAAAAT
ATTAATTAAGTAAATCTATATTACGTATACAGTGAATTATCTAAACAGATATAAACGCAA
AACTAAATATATATTTCAAAATAATTAAAAGTTATAGCAAATCATAACACTATTTTTAAG
ATAGCTAAGGCAGACCAAAGTAGATTTTATTCCACATTGCAAAATAGAAATAGTTTTTTA
CATTTTAAAATAGATATAGAATTCAATAAAAGGAATGAACACATTTGGATAAAATTTCAA
TTTAAATAAGGTTTTAAAGGAAACTGATTACTCAAAAAGAAAAACCAAAATAGTTTGTAC
ATTAGGGTAATTATTATAAATATATTAAAATAAAAATAGATCGACATATAATAAATTATG
CAATTATTTATTTCTAAATAGCCCTTAAAGCTCTAGTGTAGAAATGATATGCAAGCTTCT
TGATTCAGGAATGAATGTTGCAAGAATTACTTATTGTCATGGATTAAAGCAAGTAAATTT
GATAAATTTATTATAAAATGTGAACTCAAGGATTAATTGAATAGTTTTAAAAAAAAATAT
TTCCTTAAAATAAGTTTGTTATTTTATTTAAATAATATTTTCATTTAAAATAGTTTTATG
AAACAGTAATTAGCAATTTGAAATAAGCATTCAAACTCAGAAAAAGCATTCAATGTTCTA
TTATGTTAGATACAAGGGTAGAAATATATTTAACATTTTGATAATTTATCAATAAATAAA
TAAAAATAAAAATGATTATTTTAAAATGAACATATTTGGTATTTATTCTTATTCAAAAAT
ATTTAATGTAGGGTCCAGATATTAGAACTTCTTTACTAAAGGATAAAAAACCTATTGAAA
TAAAGAAAGGATAAAAATTAAAAATAAGTAAGCAAGTCTTTTATAAATTATCTTCTTACT
TTTAATAGAATATAATATCATAACAGTAATCTGATAAATTAGATGAACTATTTATTATAA
TAGTTTTTATGGCTTCAAATGGTCTTTCTTAGCATTATATTACTAAAAAATAGAAAATAA
AATAATTGAAAATATATTTTTTTAAATTAAGTCACAGCAACTTATTTTTTCCAACTTTAT
ATTGAATACTAAATTGCAAACTTGCAATTTTATTAACAGCTTTTAATAGATTTTTAATAT
AAAAAGTGGATGAGCAGCCAGAATATGAAGGAGATGAGTAAGGGATAGGTTGTTCTATAG
CTCTTTCAAAATTAGTTTAAGTTGGATAACATGTGTTATTATCAGATAATACAATATATT
CTCATGTTGTTGAAGTAAATGAGGTAAACATTACTTTACTCTTTTTTATTTTAATAAACT
TAATTTACTTACACTTTTACATAAAAAATGAATTCATTAATTAGCATAAAAGCTAAACAA
AATATTAATTATTAAATTAAAATTAATTTATTTTTAATAAATAAAAGTCTGATATTGTTG
TCTAGTTTGAAAATGAGGGAATTTTAAACGAAGTAAAAAATGTAAGACTTCCAGGTGTTA
AAATAGATTTGCCAACAATAAGTGAAGAAGGTATTTTCATAATACAATTTAAAAATGATT
AATAATTTTAATTAATACTAATAGATGAAGATTTTATCATTTCATAAGGATTAGAAAAAG
GTGTAGATTTTATAGCTGTATCTTTCGTACGTAGTGGGGAAGATATTGAATATGTAAGAG
ATCTTTTATCTCCTAGAGGGGAGCATATTAAAATCATAGCAAAAATTGAAAATATAGAAG
GTATGGAGAACTTTGAAGATATTTTAAAAAGTTCTGATGGTATTATGGTAGCAAGGTATG
TATAATCATTAATACTATTAATTTATTTTGTTTGTAATAAATTAAATCGACTAAGCAGTT
TAATTATTTAGTTAATTGTTTAATTATTTATTTATTTTAAGGTTTTATTTAAATCTTAGC
ATGAAAAAATGATCATTTATTAATTTTAAATAAAGCTTAATTTAAGATTTTATTTTAATC
TAGGCATGAAAAGTAAATTCTTTATTAATTTTTATTTTTTTAAATAAAAGAGGTGACTTA
GGTATGGTCATCCCAGCATAGAAAGTTTTCGTTGCCTAAAAATGGATGATAGATCGCTGT
CTTGAAGTAAATATAATATTTTGAATGTTATATAATTGCTCATTTTAATATAAAAAGGTT
GGTAAACCTGTAATTACTGCAACATAGATGATGGAAAGTATGGTAAAAAATCCAAGACCA
ACTAGAGCTGAAGCTAGTGATGTAGCTAATGCAGTTTTAGATGGCACAGATGCTGTCATG
CTATCTACAGAAACATCTGTAGGGTAATATCCTTGTGAATGTGTCGAAATTACCTCTTAA
ATTGCTAGAGAAGCAGAAATGTGTTACAATAATGCAGACAACTTTTTCAAAAGAACAAAA
CTGATAAGGTCAATATAATAAATATAAAAGAAATTAAATTTTTCCTTCATTTAAACTTTA
TTTTAAAATAAAATATTTAATTAAAAGAAATTTTTTTTTAAGTAATTTGATATCCAATTT
TATAAAATTAGAGAAATTTCTGACACTGAGAGTATGGCAACTAGTGCAGTATAAATGAGT
TTTGATTTAAAAGCACCTATTATTGTTGTTTTTACAATGTATGGAGAGATGGCTAGATTA
ATATCTAAATATAGACCAACAGCTCACGTGATTGTTGTAAGCAATGAACCTGGAACAATC
AAAGCTTTAACCTTAAGCCATGGCATTATTAGTCTCAAAGTTCCTTCGTTTTAAGGTTAC
ATTTTATTTTCTATATTCTATGAAAAATATTTTGAATATCTTGTTAATAATTCAACTCTT
AAAATTTAGGTATTGAAAAGCTTATAGATTATGCTATCAATCGTGCTAAAGAATTAAATT
TATGTAAGAAGGGGAATAAAGTTATAGTCGTAATGGGAAGTGAAGAAGAGGATTAAGATT
AAAGTGATATCTTAAAAGTAAAAACTGTGTCATGA


>TTHERM_00145990(protein)
MSQILRYQGKLIQYRKIQFTIKNLQYLYQSECLKITISQNINQVNLYYVYSELSKQIQTQ
NQIYISKQLKVIANHNTIFKIAKADQRMNTFGQNFNLNKVLKETDYSKRKTKIVCTLGPQ
SSSVEMICKLLDSGMNVARITYCHGLKQFYETVISNLKQAFKLRKSIQCSIMLDTRGPDI
RTSLLKDKKPIEIKKGQKLKIMDEQPEYEGDEQGIGCSIALSKLVQVGQHVLLSDNTIYS
HVVEVNESDIVVQFENEGILNEVKNVRLPGVKIDLPTISEEDEDFIISQGLEKGVDFIAV
SFVRSGEDIEYVRDLLSPRGEHIKIIAKIENIEGMENFEDILKSSDGIMVARGDLGMVIP
AQKVFVAQKWMIDRCLEVGKPVITATQMMESMVKNPRPTRAEASDVANAVLDGTDAVMLS
TETSVGQYPCECVEITSQIAREAEMCYNNADNFFKRTKLIREISDTESMATSAVQMSFDL
KAPIIVVFTMYGEMARLISKYRPTAHVIVVSNEPGTIKALTLSHGIISLKVPSFQGIEKL
IDYAINRAKELNLCKKGNKVIVVMGSEEEDQDQSDILKVKTVS