Identifiers and Description

Gene Model Identifier

TTHERM_00146030

Standard Name

NRK23 (NIMA-Related Kinase )

Aliases

PreTt26810 | 11.m00507 | 3702.m00229

Description

NRK23 plant dual-specificity MAP kinase kinase family domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04670.1 9.99838497179609e-146
Description: hypothetical protein (734 aa)
Oxytricha Contig18354.0.g51 9.997863464222902e-69
Description: Protein kinase domain
DictyBase DDB_G0275241 1.0004249259458435e-52
Description: nek3 on chromosome: 2 position 4983790 to 4987279
WormBase WBGene00022631 9.998397555368434e-52
Description: locus:nekl-2 status:Confirmed UniProt:O01775 protein_id:CCD64899.1
SGD YHL007C 1.0004783691736523e-35
Description: STE20 Cdc42p-activated signal transducing kinase of the PAK (p21-activated kinase) family; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p
Stentor Coeruleus SteCoe_16075 5.380186160021138e-32
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00146030(coding)
ATGTCCGCTTTTGATATTTAAGATGACACTCAAGAAAAAATAAATAATAAATACGAAAAG
GTAAAACTTTTAGGTTCTGGAAATCAAGGTAAAGCCTATTTATGCAAGCATGCCTAAACA
AACTAGTAGTTTGTTATTAAACAAATCTAATTAAGCTGCATGAGCGATTAAGAAATTCAA
AAACAATACAAAGAAGTATCTATCTTGAAATCTTTGAGTCATCCAAACATCATAAAATAT
TAAGATTCCTTCTTATTTAAGAAGAATTATTTATGCATAGTCATGGATTACGCAGAAGGT
GGTGATCTAGAATAGAGAATTATTTAAGCATAGAAAGCCAATACACTTTTCGATTGCAAA
ACTATACTAAAGTGGTTCACTTAGCTATGTAGTGCAGTCAGATTCATTCATAATTAAAAA
ATCATTCATAGAGATATTAAGAATAGTAATATTTTTCTTGATTCAAATGATAACATTCTT
TTGGGAGATTTTGGGATCTCGAAGAAGCTTCAGAATCCTAAAGATAAGGCCTCTACTATT
ATTGGAACACCATACTTTATGGCCCCTGAAATATGTAATCAGCAACCTTATACAAATAAA
GTAGATATATGGGCTATAGGTATCGTTCTTTTTAGGCTAGTATATTTAAAATACCCTTTT
GAGGGATTTGAAATATTTCATCTGATGCTTGCAATATCTAGAGGATAGCTTAAATTTCCT
TAAACTCCTTCCTCACCTTTAAAAAACTTAATTTAAAAACTCCTGTAAAATGATCCTAAT
AAAAGGCCATCTATCGAACAAGTATTTGAATTCGAAGAGATTAAATAGTATCTTGACAAA
TCTAGATAAGAAAAACAGATTAATTAAAACTAAACCAGATTGAACTCGTGCAGATAAACT
CGATTGACTAAAGACATAAGCACAGGAAATTTCGAGCTTTAATATAATCGAGCATAATCA
CCCTCCTTAAAAAATATTCAAAAAAGCGAATAAAAATTGTTTGAATTTGCTGTTTAAAAC
TAGTAGAATATCTAAAAAAATATTATACAGAGGCAGATGAGTAAGCATTAGGCGAGAGAT
ATATCACCTGGAATATAAAAAAATCAGAATATAAGTAAATTGCCTTCTCTAAAATCTCCA
AGTTCTTGTCCTTAAAATAATTCAAACTCTAAACAAAAGATTTAATATAATGTTGCTTCT
TCCCCTAATATTATGGGAAAACAGAATTTTGTAAATTTAAAGTACAATTCTAATTTAGAA
AATGAAAAAAATTTTTTAAATAATTTAAATAATAATTATTCGCCTAAAAAATTGAATAAA
TAATATTCTGACTGCAGTACTTCAGATAGCAGTAAAGAAACACCTAAAGTCTTATTTAAT
AATCACAAAGCTGATGAACTTTCACCAGTAATTTAAATATAAAAAGTTATGAGAAATAAT
TTATTTGCTAAGGGCTCTGAAGGATAAGTAAGCTCAAGTTGTAATAACAACCCTTTTTAA
TAGTAAAATTTCTAGCCAAGACTAAAATTTAGTGCAAGAAAATACAACAATGCTATCCGT
TTAAGTGAACAAGTTGTTACTAATACCCCACAATTAAAACCATAGATAATATAAACTCAA
GACAACTCAACTCCATAGTATTTATTTGCTCCTTAAATTAATATCCCTTAGTCATAGCAA
CAGTAATAACAATAATATACTCCAATAATTATAAACTACAAACAGCCTAAAAACGACATA
AAGACAAGACCTTCTCTGAATCTTAAGTAATAGTTTTCAGATAATTCTGTTTCTGTGAAG
GAAAATATTCACTAATAGAACTAGTATATTGAAGCAGTAAAAAAGTAAATGAATAGACCG
AGTAAAGAATTTTAGGTCAACTAATTGCAAGGATAGCAATAACCATAAATAATACATTAA
ATATTTAAATAACCATAAAAAAATCAAGAACCTGAGAATTTTTAGTAAGCTGTGCAAGAT
TTTCATGATGATTTTGAGTAAAATTAAGAAGACCAAATGATCTGCTCTTTAAATACAGTG
CTTTCTCAAGATTTTATAGAAAATAATTAAAATATTTAAGAGAATAATTCAATTGAGAAG
ACTAATATGCTAAGAATCTTCAAAAGAAATAGTAGTAATAATTACAACAGCTAAAACAGT
CACCAATTACAAAACAATGGAAGTAACATTTTAAATCCCAACAACAATAGCAGTGGAAAT
TATGCATTTTAAAATAATATGAGTGGAAGTAGTAGTAATAATAGCTAGAACTTTTACAAC
TTTGGTGCTAATTTGATATCAAATAGCAGTAATTTATTTAATAACCAAAGCAATAACTAG
ATTCCTTAAAGCTTAGACAATAAATAAAATCAAGATTAGTACTAAGATATTTAAGAAATG
TTTAACAAGAACTCTAATTTAAAAACATCTTAAATGCAATTAGAAGACATAGAAAATGAA
AATAATAATTAGTAGCTGCTTAATAACTATTAAGATGATAACCTAGCTATATCATATAAC
TATACAAGATCATCTTTGTCTGACATAAACTCTATTTTATAATCAACTTAAAACAAAGAA
GAAATAGTAGCAAATCCAGAAGAAATAATAGAGTAATTAAAGCAATAATTGATACTATTA
TTAGGCGAAGAACTATTTTTCTAAGTATCTCATTACGCCACTAGACTCATTTTACATTAC
GATATTTCTAAAATAATCAATGAGAATATGCTAAAGGATAACTTCCTTTCATAATGCAAA
TAATATAATTAGGCGAGTTAGCTTATGAATGTTGATCAAATAGTATATAACCTCTTAAAA
ATTGTCAACTATGAAGAAAACAACATTTTAATAGGCTGA


>TTHERM_00146030(gene)
ATGTCCGCTTTTGATATTTAAGATGACACTCAAGAAAAAATAAATAATAAATACGAAAAG
GTAAAACTTTTAGGTTCTGGAAATCAAGGTAAAGCCTATTTATGCAAGCATGCCTAAACA
AACTAGTAGTTTGTTATTAAACAAATCTAATTAAGCTGCATGAGCGATTAAGAAATTCAA
AAACAATACAAAGAAGTATCTATCTTGAAATCTTTGAGTCATCCAAACATCATAAAATAT
TAAGATTCCTTCTTATTTAAGAAGAATTATTTATGCATAGTCATGGATTACGCAGAAGGT
AAATAATTCAACATTCAACTTTACAAAAATGCACACAATTGCTTTATTTAGAAGCAGAAA
CCATCATACAAACAATTATAATATGCTTTTCATATTCACTGAAGAATAAAAATAAAAATT
TTTGCTACAAATATGGATTTCATTTTTAGAAATTTTGATAATATAGTGTATTAGTAGTTT
ATAGTTTTAATTAAAGATTCAATAGCAAGTAAATGCATTAGTGGAGTTCATGGATATTAT
TGATGATTACTAATTAATTATCTTAGTAATCAATCGTATATTTATTATTGTTATCCAGTT
TCTTAATTAATTTTTAAATCATAAAATTTAAAAATTGAAAGATTTTACAATCAGAGTATC
TAATAAATCATTTATTTATCAATAGCAACAATCACAAAAAAAAATTAGCATTTCAATGAT
CAATTTTTCATATAAATTTTATAATATTTAATACTTGAAAAATTATAAAGATGTATTTGA
GATTTATCTTTCATTCCATACCTCTGAATCTAAATTACGGATTATTCTTTATAAAATTTA
AATTTATTAACACTTCTTTATTTCAGAAACTCCCTATCGAAATCTTGCAAAAATATAATC
CTCTCTTTTAGATATTTAAATATCTGAAATATAATAATTAATAAATTTAAATAACTAAAT
AAGAAGTAGATTATTTTATAATTATGAATTAATGACTGACTGCTATAATAAATTAGTTTA
CATTTTATAAATTTATTTTAAATATTTAAAGGTGGTGATCTAGAATAGAGAATTATTTAA
GCATAGAAAGCCAATACACTTTTCGATTGCAAAACTATACTAAAGTGGTTCACTTAGCTA
TGTAGTGCAGTCAGATTCATTCATAATTAAAAAATCATTCATAGAGATATTAAGAATAGT
AATATTTTTCTTGATTCAAATGATAACATTCTTTTGGGAGATTTTGGGATCTCGAAGAAG
CTTCAGAATCCTAAAGATAAGGCCTCTACTATTATTGGTAAGGATCAAATATTTGTTTAT
TTAATTAATTAAATAATTTAAATTTTCTAATGAATTAAAATTTTATTTTTAATAAATTTA
TAAAGGAACACCATACTTTATGGCCCCTGAAATATGTAATCAGCAACCTTATACAAATAA
AGTAGATATATGGGCTATAGGTATCGTTCTTTTTAGGCTAGTATATTTAAAATACCCTTT
TGAGGGATTTGAAATATTTCATCTGATGCTTGCAATATCTAGAGGATAGCTTAAATTTCC
TTAAACTCCTTCCTCACCTTTAAAAAACTTAATTTAAAAACTCCTGTAAAATGATCCTAA
TAAAAGGCCATCTATCGAACAAGTATTTGGTAAAAGAATATACTTTTATTTTAAAAATAA
TTCATCGTATTGTTTTAATTAAAAAACGAAAAAGATTATTCTTAATATTAACTTTATAAC
TTTTTTATATTTAAAAAGAATTCGAAGAGATTAAATAGTATCTTGACAAATCTAGATAAG
AAAAACAGATTAATTAAAACTAAGTAATAGTTTCTTTAATTTCTTTTCAATTATTTACCT
TAATTAATTAATTTATTAATTATTTAAAATTTAAATATTTAACTTAATTTTTAGACCAGA
TTGAACTCGTGCAGATAAACTCGATTGACTAAAGACATAAGCACAGGAAATTTCGAGCTT
TAATATAATCGAGCATAATCACCCTCCTTAAAAAATATTCAAAAAAGCGAATAAAAATTG
TTTGAATTTGCTGTTTAAAACTAGTAGAATATCTAAAAAAATATTATACAGAGGCAGATG
AGTAAGCATTAGGCGAGAGATATATCACCTGGAATATAAAAAAATCAGAATGTATTGATT
TATTTAATAATTTTTAATTGTTTCGAATTTATTAGTCTCAACATTTATTTATTTAAAAAA
TATAGATAAGTAAATTGCCTTCTCTAAAATCTCCAAGTTCTTGTCCTTAAAATAATTCAA
ACTCTAAACAAAAGATTTAATATAATGTTGCTTCTTCCCCTAATATTATGGGAAAACAGA
ATTTTGTAAATTTAAAGTACAATTCTAATTTAGAAAATGAAAAAAATTTTTTAAATAATT
TAAATAATAATTATTCGCCTAAAAAATTGAATAAATAATATTCTGACTGCAGTACTTCAG
ATAGCAGTAAAGAAACACCTAAAGTCTTATTTAATAATCACAAAGCTGATGAACTTTCAC
CAGTAATTTAAATATAAAAAGTTATGAGAAATAATTTATTTGCTAAGGGCTCTGAAGGAT
AAGTAAGCTCAAGTTGTAATAACAACCCTTTTTAATAGTAAAATTTCTAGCCAAGACTAA
AATTTAGTGCAAGAAAATACAACAATGCTATCCGTTTAAGTGAACAAGTTGTTACTAATA
CCCCACAATTAAAACCATAGATAATATAAACTCAAGACAACTCAACTCCATAGTATTTAT
TTGCTCCTTAAATTAATATCCCTTAGTCATAGCAACAGTAATAACAATAATATACTCCAA
TAATTATAAACTACAAACAGCCTAAAAACGACATAAAGACAAGACCTTCTCTGAATCTTA
AGTAATAGTTTTCAGATAATTCTGTTTCTGTGAAGGAAAATATTCACTAATAGAACTAGT
ATATTGAAGCAGTAAAAAAGTAAATGAATAGACCGAGTAAAGAATTTTAGGTCAACTAAT
TGCAAGGATAGCAATAACCATAAATAATACATTAAATATTTAAATAACCATAAAAAAATC
AAGAACCTGAGAATTTTTAGTAAGCTGTGCAAGATTTTCATGATGTAATGAAATATTTAA
CTTTTTACAAAATTAAATAGGAAATAAAAATATTTATTTTTTAAATTAATTAGGATTTTG
AGTAAAATTAAGAAGACCAAATGATCTGCTCTTTAAATACAGTGCTTTCTCAAGATTTTA
TAGAAAATAATTAAAATATTTAAGAGAATAATTCAATTGAGAAGACTAATATGCTAAGAA
TCTTCAAAAGAAATAGTAGTAATAATTACAACAGCTAAAACAGTCACCAATTACAAAACA
ATGGAAGTAACATTTTAAATCCCAACAACAATAGCAGTGGAAATTATGCATTTTAAAATA
ATATGAGTGGAAGTAGTAGTAATAATAGCTAGAACTTTTACAACTTTGGTGCTAATTTGA
TATCAAATAGCAGTAATTTATTTAATAACCAAAGCAATAACTAGATTCCTTAAAGCTTAG
ACAATAAATAAAATCAAGATTAGTACTAAGATATTTAAGAAATGTTTAACAAGAACTCTA
ATTTAAAAACATCTTAAATGCAATTAGAAGACATAGAAAATGAAAATAATAATTAGTAGC
TGCTTAATAACTATTAAGATGATAACCTAGCTATATCATATAACTATACAAGATCATCTT
TGTCTGACATAAACTCTATTTTATAATCAACTTAAAACAAAGAAGAAATAGTAGCAAATC
CAGAAGAAATAATAGAGGTAACTATCTATTTATTATACAAATATTTTTAATAAAACATTT
CTCTAATATATTTTTTTTTATAGTAATTAAAGCAATAATTGATACTATTATTAGGCGAAG
AACTATTTTTCTAAGTATCTCATTACGCCACTAGACTCATTTTACATTACGATATTTCTA
AAATAATCAATGAGAATATGCTAAAGGATAACTTCCTTTCATAATGCAAATAATATAATT
AGGCGAGTTAGCTTATGAATGTTGATCAAATAGTATATAACCTCTTAAAAATTGTCAACT
ATGAAGAAAACAACATTTTAATAGGCTGA


>TTHERM_00146030(protein)
MSAFDIQDDTQEKINNKYEKVKLLGSGNQGKAYLCKHAQTNQQFVIKQIQLSCMSDQEIQ
KQYKEVSILKSLSHPNIIKYQDSFLFKKNYLCIVMDYAEGGDLEQRIIQAQKANTLFDCK
TILKWFTQLCSAVRFIHNQKIIHRDIKNSNIFLDSNDNILLGDFGISKKLQNPKDKASTI
IGTPYFMAPEICNQQPYTNKVDIWAIGIVLFRLVYLKYPFEGFEIFHLMLAISRGQLKFP
QTPSSPLKNLIQKLLQNDPNKRPSIEQVFEFEEIKQYLDKSRQEKQINQNQTRLNSCRQT
RLTKDISTGNFELQYNRAQSPSLKNIQKSEQKLFEFAVQNQQNIQKNIIQRQMSKHQARD
ISPGIQKNQNISKLPSLKSPSSCPQNNSNSKQKIQYNVASSPNIMGKQNFVNLKYNSNLE
NEKNFLNNLNNNYSPKKLNKQYSDCSTSDSSKETPKVLFNNHKADELSPVIQIQKVMRNN
LFAKGSEGQVSSSCNNNPFQQQNFQPRLKFSARKYNNAIRLSEQVVTNTPQLKPQIIQTQ
DNSTPQYLFAPQINIPQSQQQQQQQYTPIIINYKQPKNDIKTRPSLNLKQQFSDNSVSVK
ENIHQQNQYIEAVKKQMNRPSKEFQVNQLQGQQQPQIIHQIFKQPQKNQEPENFQQAVQD
FHDDFEQNQEDQMICSLNTVLSQDFIENNQNIQENNSIEKTNMLRIFKRNSSNNYNSQNS
HQLQNNGSNILNPNNNSSGNYAFQNNMSGSSSNNSQNFYNFGANLISNSSNLFNNQSNNQ
IPQSLDNKQNQDQYQDIQEMFNKNSNLKTSQMQLEDIENENNNQQLLNNYQDDNLAISYN
YTRSSLSDINSILQSTQNKEEIVANPEEIIEQLKQQLILLLGEELFFQVSHYATRLILHY
DISKIINENMLKDNFLSQCKQYNQASQLMNVDQIVYNLLKIVNYEENNILIG