Identifiers and Description

Gene Model Identifier

TTHERM_00149300

Standard Name

RPS4 (Ribosomal Protein of the Small subunit 4)

Aliases

PreTt20689 | 12.m00363 | 3700.m00085

Description

RPS4 40S ribosomal protein S4; Homolog of yeast RPS4- human RPS4;

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04990.1 9.997093137033517e-262
Description: ribosomal family S4e containing protein (261 aa)
Oxytricha Contig21054.0.g58 9.99679536751975e-103
Description: Ribosomal family S4e
SGD YJR145C 2.000724368835138e-100
Description: RPS4A Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein
DictyBase DDB_G0272825 3.9985196551577655e-99
Description: rps4 on chromosome: 2 position 2019070 to 2020303
WormBase WBGene00004473 2.0001925730668994e-91
Description: locus:rps-4 40S ribosomal protein S4 status:Confirmed UniProt:Q9N3X2 protein_id:CCD74049.1
Stentor Coeruleus SteCoe_30262 2.2856936767186716e-49
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00149300(coding)
ATGAAAGGCAAGAAAAGAAAAATACGAAAGAAATTTAGTTAAAATATCAAAATAATTAAA
GGAGTTTAAAATTAGTGTATAGAAGAGGGATGTATGAAATTAGGCCTAATAAAGAAGAAG
AAAAGAATTTTAGAGTGGGGATAAAAGTTAAATTAATAAAGGAAAGATATTAAAAATTAA
TAAACACCAAATAAAAAGAAGAAAACAAAAATGGCTCGTGGTCCTAAAAAACACTTAAAG
AGAATCAACGCTCCCAAGTCTTGGATGCTCAACAAGTTGGGTGGTATCTGGGCTACCAGA
CCTTCCCAAGGTCCTCACAAGCTTAGAGAATCTCTCCCTCTCTCTGTCTTACTCAAGGAA
AGACTTAACTACGCTTTGAACGGTAGAGATGTCACCCTTATCCTCAACGATAAGGAATAA
AACGTCTTTGTTGACGGTAAGGTCAGAAGAGACAAGGGTTACCCCACTGGTCTTATGGAT
GTCGTCAGAATTGAAAAGACTGACTAATCTTTCAGAATCCTCTACGACACCAAGGGTAGA
TTCGTCCTCAAGTCCCTCAGCAAGGAAGAAGCTAAGTACAAGCTCTTGAAGGTCACTGCT
AAGGCTATTGGTCCCAACCAAATCCCTTACATCGTTACCCACGACTCTAGAACCATCAGA
TTCCCTAACCCCGAAATCAAGATCGGTGATACCCTTAAATACGATCTCGTTAACAACAAG
ATTGAAAACTTCGCTCACTTAGAATCCGGTAATGTTTGCTACATTCAATAAGGTAACAAC
ATCGGTAGAGTCGGTATCATCTAACACATCGAAAAGCATCAAGGTTCCTTCGATATTTGC
CACGTTAAGGATGCTAAGGGTAACGCTTTCGCTACCAGATTAGGTAACATCTTCGTCTTA
GGTCAAGGTAAGAAGTCCTGGATCGAACTTCCTTCCGGTGATGGTGTTAGAGAAACTATT
CTTGAAGAAAGAAAGAGAAAGTTCTCTTACTGA


>TTHERM_00149300(gene)
ATGAAAGGCAAGAAAAGAAAAATACGAAAGAAATTTAGTTAAAATATCAAAATAATTAAA
GGAGTTTAAAATTAGTGTATAGAAGAGGGATGTATGAAATTAGGCCTAATAAAGAAGAAG
AAAAGAATTTTAGAGTGGGGATAAAAGTTAAATTAATAAAGGAAAGATATTAAAAATTAA
TAAACACCAAATAAAAAGAAGAAAACAAAAATGGTAATCCTTTGAATAATTTACAACTTA
AAACAGCATAAGATATTGCATATATTTTATGCTTAATATACAAATTAATTTCTATTACAG
TCCCTCATTTTTTTTCTTTTGAAATTTATAAAAAGGCTCGTGGTCCTAAAAAACACTTAA
AGAGAATCAACGCTCCCAAGTCTTGGATGCTCAACAAGTTGGGTGGTATCTGGGTAATTA
CATTTTTTGCATTTCGTCTTAGAAAAAATGACTTTATTACTACAATTCCTAAACTTAAAT
TTATTTATTTTAAAAAATAGGCTACCAGACCTTCCCAAGGTCCTCACAAGCTTAGAGAAT
CTCTCCCTCTCTCTGTCTTACTCAAGTAAGAATATAAAAAATAAACATAATTTTTGATTC
TTCTCGTTTTTGTAATCGTCAAATACTTAGAGCCCAAGGAAAAATTTAAAGCAAAATGAA
TAAAGTTACAACTTAAAATTGATTTATATAGATTTATTGCTTTTAAGATTTAATAGAGGT
AGAATTAGGAGCAATTGTTAATAAATTATTTTAGCCTTATTAGCCTAGATTAGCTTAATT
AGCTAGCAGCAATTTCATTAAATTGTTTGATGTAAAATCAATTAAATTGATCTTAAATTT
GAATTCAATGTACTTAAATTGATGGCAATTGCTCTGCTTGCTTGGCCTCTTAGAGTCTCT
TAAAATTAGAGAGTAAAAGAATGAGGCTATATCATAATAGTATCATCATAAGTTGTGAAG
ATTTGTTAATGTTAGGAATGATCAAATTTAGTAAATAAGTAAGTGAGTGATTTAGTGAGA
GAGTAATTAAAAAAAAGAAAATATTCATAAGGTGTAGCAAAGCATATTTATTAAGCTAAT
AAAAAGAAAAATAGGAAAATAATAATTTGAAAAAATGGATAAACAATTGCAAAAGCTAAT
AAATTTTCTAAACTTTCATTAGAAAACGTTAAAAAAACTAGCAATCTCTCATTAGAATTA
TAACTAGATACTATTTCTAATAATTGCTTATTTCTACCATCTCATGTCTGCCTTAACAAT
AAATGCAAACTTACACATACATACATATCTAAAACTTAATAAATAAATAAATCAATGAAT
TATTAATTTATTAATTAATAAATTAATTGAGGCTAAAGATATTTATCATTTTAATAAATT
TAGATTCCTTGAATGCTTAAATATTTTGACTATTACAACAAGCAAGCAAATGAAGAATTT
ATTTTATTCAAATAATAAAAATGGAAATTAATTATTTAATTTTTTTTGATGTAACTACTT
AGGGAAAGACTTAACTACGCTTTGAACGGTAGAGATGTCACCCTTATCCTCAACGATAAG
GAATAAAACGTCTTTGTTGACGGTAAGGTCAGAAGAGACAAGGGTTACCCCACTGGTCTT
ATGGATGTCGTCAGAATTGAAAAGACTGACTAATCTTTCAGAATCCTCTACGACACCAAG
GGTAGATTCGTCCTCAAGTCCCTCAGCAAGGAAGAAGCTAAGGTAAAAATAACAATCTAA
AAAAAGCTAAATTTATTGCTTGTTATATACATGAAATTATGTATGCACTCATCCCCAACT
TATAATTTAGAAATAAATCTTAAAACAAAAACAGATTAGCAAAATAAATAACTGAATTTA
TGAATAAATAAATCTCTCTAATTAGCATTTCAAGCAATTTAGCTATTTTCAACATTTATT
TTTGTAATCCAAATGTGCTAAATTCTATTTTTATATTCAATAGTACAAGCTCTTGAAGGT
CACTGCTAAGGCTATTGGTCCCAACCAAATCCCTTACATCGTTACCCACGACTCTAGAAC
CATCAGATTCCCTAACCCCGAAATCAAGATCGGTGATACCCTTAAATACGATCTCGTTAA
CAACAAGATTGAAAACTTCGCTCACTTAGAATCCGGTAATGTTTGCTACATTCAATAAGG
TAACAACATCGGTAGAGTCGGTATCATCTAACACATCGAAAAGCATCAAGGTTCCTTCGA
TATTTGCCACGTTAAGGATGCTAAGGGTAACGCTTTCGCTACCAGATTAGGTAACATCTT
CGTCTTAGGTCAAGGTAAGAAGTCCTGGATCGAACTTCCTTCCGGTGATGGTGTTAGAGA
AACTATTCTTGAAGAAAGAAAGAGAAAGTTCTCTTACTGA


>TTHERM_00149300(protein)
MKGKKRKIRKKFSQNIKIIKGVQNQCIEEGCMKLGLIKKKKRILEWGQKLNQQRKDIKNQ
QTPNKKKKTKMARGPKKHLKRINAPKSWMLNKLGGIWATRPSQGPHKLRESLPLSVLLKE
RLNYALNGRDVTLILNDKEQNVFVDGKVRRDKGYPTGLMDVVRIEKTDQSFRILYDTKGR
FVLKSLSKEEAKYKLLKVTAKAIGPNQIPYIVTHDSRTIRFPNPEIKIGDTLKYDLVNNK
IENFAHLESGNVCYIQQGNNIGRVGIIQHIEKHQGSFDICHVKDAKGNAFATRLGNIFVL
GQGKKSWIELPSGDGVRETILEERKRKFSY