Identifiers and Description

Gene Model Identifier

TTHERM_00149798

Standard Name

RPS6 (Ribosomal Protein of the Small subunit 6)

Aliases

3700.m01683

Description

Homolog of yeast RPS6- human RPS6;; RPS6 40S ribosomal protein S6

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05038.1 9.996149531968772e-161
Description: hypothetical protein (298 aa)
Oxytricha Contig14465.0.g80 2.000341663036036e-86
Description: Ribosomal protein S6e
SGD YPL090C 9.999776257620412e-83
Description: RPS6A Protein component of the small (40S) ribosomal subunit; identical to Rps6Bp and has similarity to rat S6 ribosomal protein
WormBase WBGene00004475 3.9983507938127826e-75
Description: locus:rps-6 40S ribosomal protein S6 status:Confirmed UniProt:Q9NEN6 protein_id:CAB81996.1
DictyBase DDB_G0280823 9.000650761534676e-74
Description: rps6 on chromosome: 3 position 1442353 to 1443385
Stentor Coeruleus SteCoe_32377 6.639677199580735e-36
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00149798(coding)
ATGAAATTCAACATTAGTTATCCTCTCACTGGTGCTCAAAAGTGCATCGAAATCGACGAC
GACAAGAAATGCAACATCTTCATGGACAAGAAGATGGGTCAAGAAGTCGAAGGTGATACC
TTGGGTGACGAATTCAAGGGATACGTCTTCAAGATTGCTGGTGGTAACGATAAGGACGGT
TTCCCCATGAAGCAAGGTGTCATGGTCAGAGGTAGAGTTAGACTCCTTCTCAGTGAAGGT
CACTCTTGCTTCACCAGCAGAAGATCTGGTTTCAGAAAGAGAAAGTCTGTCAGAGGTTGC
ATCGTTGGTCCCGATATGAGAGTTCTTGCTCTTCAAATCGTCAAGAAGGGTGTTGCTGAA
ATCGACGGTCTTACCACTGTTACTTTACCCAGAAAGCTTGGTCCCAAGAGAGCTAACAAC
ATCAAGAAGTTGTTCGGCTTGAAGAAGGAAGATGATCCCATTCTCATCAAGAAGTCCGTC
ATCAGAAGAACCTTCAAGACTGCCAAGGGTAAGGATAGAACAAAATGCCCCAAGATCCAA
AGACTTATTACCCCTGAAAGAATCCTCAGAAAGAAGGTTTACAAGGCTGAAAAGACCCAA
AGATACGTTAAGACTAACGCTGCTAAGGAAGAATACGAAAAGTTCTTAAGTGAATGGAAG
AAGCAAAGAGCTGCTAAGGCTCACGCTGCCAGCGCTCCCGTTGTTGAAGCTCCCAAGAAG
GTTGAAGCCCCTAAGAAGGTTGATCCTAAGGCTGCTAAGACCACCCCTGCTGCTACCAAG
GCCACCCCTGCTGCTACCAAGGTTGCCCCTAAGACCCAAGCTGCTAAGACTACTACCCCT
GCTCCCGCTGTTAAGGATGCTAAAAAAACTACCAAAAAGTGA


>TTHERM_00149798(gene)
ATGAAAGTAATTTTTTTTCTTTGTTTTGAAGCAGAATTTATAATATAATTCTAATAATAG
AATAACAAAAATATATTATAATCCAAAATCCTATCTGTTTTAACATATTCTATTTTATTA
AAAAATAGTTCAACATTAGTTATCCTCTCACTGGTGCTCAAAAGTGCATCGAAATCGACG
ACGACAAGAAATGGTAAAGATATTATCATAATTAATCAATTGTTTGTTTTCATCATCATC
ATTTATCTCACATTCCTTCAGCAATATTTTTTGCAAGAAACACACTAAAAAAAGGAAAAT
GGTTTTAGCGAATATTTAGAATTCTAAAAGAATTAAAGTGGTAAAAAATGATTTTGAGGA
AAGTCTGTATCAGTAGAATTTATTTTTAATAGGTTTTCTCAGCATAATTTTAGCTAACAA
TTTTTAGAGGGAAGAATATTAATTTTGAGCAGTATTTGAATTTTGATGCCAAATAGGAAG
CTGAGATTTTGAATAACGCTAAATTCTATCATTTTCCTACCAACAAAGATATTGAAATAT
AATGATGATGATGAAGCTATTTTGATTTCATTCGGATATAAATTATATTCTGAAACACTC
TAATTATATTTTAAGAATAACTAACAATTTTTCTTTTATATATAGCAACATCTTCATGGA
CAAGAAGATGGGTCAAGAAGTCGAAGGTGATACCTTGGGTGACGAATTCAAGGGATACGT
CTTCAAGATTGCTGGTGGTAACGATAAGGACGGTTTCCCCATGAAGCAAGGTGTCATGGT
CAGAGGTAGAGTTAGACTCCTTCTCAGTGAAGGTCACTCTTGCTTCACCAGCAGAAGATC
TGGTTTCAGAAAGAGAAAGTCTGTCAGAGGTTGCATCGTTGGTCCCGATATGAGAGTTCT
TGCTCTTCAAATCGTCAAGAAGGGTGTTGCTGAAATCGACGGTAAATAAAATTATAAAAT
ATAGATGTTTTATTGCTCTTGGATATATTTATTTAATTGATTGATGTAATTGTGAATGTC
TTTTCTATGATAGTCAATTTAAGCATTTTCTCAGTTTCTTTAGTAGATTTAGTTCTTTTT
GAAGAAAACTATGATTTTAATTGAAATATTAGAGAAATAGTAGATAGGTAGGTAGGATAA
TACTTTTTAAAGTAAAAACGAATAGATAATATATTATTATTAACTCAAAATAAGTCAAAA
GTTCAAATATCTATTTTTTTTGTCAATTCTTTGCTTGAAAATGAATAGTAAGATATCTAT
CTAACTATCTATCCACTATAGGTTTCAAATATTAATTAGTATCAAAACTAAGGACAAAAT
TAGCTTAGAGTGAAAGCAATAATCTAAATAAATAAATCAATCTATTAACCAATTAATAGC
TCTCAAAATTAAAGATAGCAAAAGTATTTAGTTTCCCTCAAAGTTTAGAAATCATTCATT
TGTATAATTAACCAATCAATATGATCAATAAATTAATTAATTTTCTGTTTCAAATACTTC
TGTTTTATAAGAGCTAATTAATAAATAAATGCATTTATTCTATTTACAGCTAGATAAATA
GACAGCTGGAGGTATCTTAAATCAAACAATCAACATAATTACAATAATATTCTAAATGCT
TATTTTAAGTAAATTTAGATATTTAATGTAAATTAATTAATGTTTGCACTAAAATATACA
AAAGATTAAATGAATTAGCTTAAATATGTATAGCTTGCTATTAATTATACTGGATAAGTA
ACTAAAACTTAAAAATAATTTAGTGATCTATACTATGATTTGATTAAATTGCACAGTAAG
ATGCTAACTTACTCAAAAATTATCATTAAAGAGACTCATTCAGTCACATACTCACAATTA
AATTTAATATCCAAGACAATTAATTCATTGATTTTTATAAATTTCTTTCTCTCTATAAAA
AAATTAAAATTAACTTATTTTATCTAATTTAGGTCTTACCACTGTTACTTTACCCAGAAA
GCTTGGTCCCAAGAGAGCTAACAACATCAAGAAGTTGTTCGGCTTGAAGAAGGAAGATGA
TCCCATTCTCATCAAGAAGTCCGTCATCAGAAGAACCTTCAAGACTGCCAAGGGTAAGGA
TAGAACAAAATGCCCCAAGATCCAAAGACTTATTACCCCTGAAAGAATCCTCAGAAAGAA
GGTTTACAAGGTAAAACTTACAAACATCTATCTAGTTAATTTAAATTAACTTAATATTCT
TAATAATAGGCTGAAAAGACCCAAAGATACGTTAAGACTAACGCTGCTAAGGAAGAATAC
GAAAAGTTCTTAAGTGAATGGAAGAAGCAAAGAGCTGCTAAGGCTCACGCTGCCAGCGCT
CCCGTTGTTGAAGCTCCCAAGAAGGTTGAAGCCCCTAAGAAGGTTGATCCTAAGGCTGCT
AAGACCACCCCTGCTGCTACCAAGGCCACCCCTGCTGCTACCAAGGTTGCCCCTAAGACC
CAAGCTGCTAAGACTACTACCCCTGCTCCCGCTGTTAAGGATGCTAAAAAAACTACCAAA
AAGTGA


>TTHERM_00149798(protein)
MKFNISYPLTGAQKCIEIDDDKKCNIFMDKKMGQEVEGDTLGDEFKGYVFKIAGGNDKDG
FPMKQGVMVRGRVRLLLSEGHSCFTSRRSGFRKRKSVRGCIVGPDMRVLALQIVKKGVAE
IDGLTTVTLPRKLGPKRANNIKKLFGLKKEDDPILIKKSVIRRTFKTAKGKDRTKCPKIQ
RLITPERILRKKVYKAEKTQRYVKTNAAKEEYEKFLSEWKKQRAAKAHAASAPVVEAPKK
VEAPKKVDPKAAKTTPAATKATPAATKVAPKTQAAKTTTPAPAVKDAKKTTKK