Identifiers and Description

Gene Model Identifier

TTHERM_00149910

Standard Name

MRNC18 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt20751 | 12.m00425 | 3700.m00146

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00473 ) Corticotropin-releasing factor family
  • ( PF00643 ) B-box zinc finger
  • ( PF02493 ) MORN repeat
  • ( PF07661 ) MORN repeat variant
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05054.1 9.997093137033517e-262
Description: hypothetical protein (747 aa)
Oxytricha Contig14161.0.g64 4.0009493637353324e-18
Description: MORN repeat
DictyBase DDB_G0349488 0.0000000039998859049333245
Description: DDB_G0349488 on chromosome: 2 position 6912714 to 6914186

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149910(coding)
ATGAGTCAGCAATCATAAGTTTCTAACAAAAATAATTTTAGAAGGAGAACAATAAATAGC
TAATAACTCGAATTTTAGTCTCCTGAAAAAGAATCGAATGCCAATGATTAACCTAAATTA
TCTTAGGATTCAATATGTGAGTAATAAGAATAATAGATATCAGTAAACTTATCCATTGAC
AATTCTTTGCAGAGCAATTCATAAAAAGATGATTAAGGGATAATAACACCTAAAAAAGAT
AAAATTTTAGTTCAGTCTTTTACTGACGCATTGATACAGCAAAACAACTAGTAAAATAAT
AAATAGTTAATATCAAAGAATTTTCTTTCTCCTACTTCATCATAATCTAGCAATAAATCA
AGGAGTTCTTTATCATCACCAATATAAATTAGAATAAATCCTAATTAATACTAAATATCT
AACAATACTGCTCGTCGCAGTTTAAATTATGAAATTAGCTAAATTTAAGAAAAGAGGCTA
GAGGATGAAAAAACAGCCATATCTTATGCTGAAAAAGTTTTATAAAGTAGAAACTTTTTA
AGCCAATAAAAGAGCAAGCAAGAAAATTAAAGATATTCTTTGTTTGTAACAACAGCTTAA
CAAGCTGGAGTATACGTAGGTAAAGAAGGGTAATAATAGGGGATTTTAAAAAAAAAGACG
AATAATAACTATTTTACTAATACAAACTAATTATTCAATACCTAAAACTAGCTCACCTTC
ATTGCTGATAAAACAAAATCTGTAGAATTAAATGAAAATAATATCTAACAAGATGAAAAA
AACAACCTTAATAATTCCAGTAGTAAAATTAATAAAATTTTACTTCCAGACAGAAGTGAA
ATCACAAACAAAATAAATGGTGCTGAAATAAATCAATTTGTAGCTTCAGACAACAAAAAA
GTAAATTTTTAGACATTATCCTAATAGCCAGCTTCTTCAAAAGTAAGAAGTAGGAAAGTG
GGAAGCAGTAGCTTAAATAATGAGGTTATCAGTGGTAAAGAAATTTCAATTCTAGATAAA
AAAGCTCTCACAAAAATAACAAAAGTAAACACTGAAAGAAACAGTATTATTTAACCTGAG
AGAAGTATGGATGATCATTATAATAAATTGCCACGTTGCTATGAGCATTCAAAAAGAATT
AAAGAACTGTATTGTGTAGATGATAATTGTTAAGTGAAAAATAAATTTGGATGTGTTCTC
TGTTTTAGCTCTGTCAACGGATCACCTCACAGTTTCCATGAATATTACACAATTTCCTCA
GAAGAAGATTTACAAGCTAAAATAAATAGAAATAGATAAGATTTTATTCAATTTATTTAA
GATAAGATTCAATTCAAGTGCCAAGATAAGAAATCTTAATTTTATATGTATTAAGATTAA
ATCACAGAATCTTTAATTAATTATGCTGATTCTATACAGGATAGGCTATTTATAGGATTT
GAGGCAGAAGAAATACAAAAATTTTAGCTCCCTCTTTTGTAGGGAAGTATTGAAAGAAAG
AGTCCAGCAAAAAAATCAAAGCGAAATTCTAAAGAAAATAGGGAAGAATTCGATGAAAAA
GAATTATCAATAATCTTGTACATAGACCTACTTGAGAAATAATTGAATAAAAAAATAGAA
AATTAGAATAAAATATGGCTACAACAAATCTATCTTGGTGAAAAAAATGAAGAATTTTTA
AAGGAAAAGAAATGTAAATTAATTATAGCTGGTAAATGCTTTAGCAATCTTAGTGATCAA
ATATTAAAATTATACTTAACTAGTGAGCAGGTTAATTATGATTTATAAGAACTAGAAAAC
AACAAATCATAGCTGTATTATATAAATGATGAAAATAGTGATGGTATTTATTAATTAGAT
GATGATAAAGTAAAATAAGGAAGAGGAATTTAATTTTTTAAGAGTGGAGGTTTATATGAA
GGGTATTTTAAAAATAATTAAAAGCATGGAAAAGGGAAACTAATTACATTTGAAGGAGAT
GTTTACATAGGAGAATTTCAAAAAAACATGAAAAGAGGAAGAGGTGTATTAACCTACTCG
AATAAAGATATATATGATGGAGAATTTTATTAAGACACATGTCACGGAATTGGAAAAATG
AGTTATGCTAAAGACTAAGTTGTATATATAGGTGGATGGAATAAAAATTAAAGGCATGGA
AAAGGATAAATTTTTAAAGACAATGAACTAATATTCTCAGGCGTATATATAGGAGACAAC
CCTAAGGCTAATAGTAAAGAATGA


>TTHERM_00149910(gene)
ATGAGTCAGCAATCATAAGTTTCTAACAAAAATAATTTTAGAAGGAGAACAATAAATAGC
TAATAACTCGAATTTTAGTCTCCTGAAAAAGAATCGAATGCCAATGATTAACCTAAATTA
TCTTAGGATTCAATATGTGAGTAATAAGAATAATAGATATCAGTAAACTTATCCATTGAC
AATTCTTTGCAGAGCAATTCATAAAAAGATGATTAAGGGATAATAACACCTAAAAAAGAT
AAAATTTTAGTTCAGTCTTTTACTGACGCATTGATACAGCAAAACAACTAGTAAAATAAT
AAATAGTTAATATCAAAGAATTTTCTTTCTCCTACTTCATCATAATCTAGCAATAAATCA
AGGAGTTCTTTATCATCACCAATATAAATTAGAATAAATCCTAATTAATACTAAATATCT
AACAATACTGCTCGTCGCAGTTTAAATTATGAAATTAGCTAAATTTAAGAAAAGAGGCTA
GAGGATGAAAAAACAGCCATATCTTATGCTGAAAAAGTTTTATAAAGTAGAAACTTTTTA
AGCCAATAAAAGAGCAAGCAAGAAAATTAAAGATATTCTTTGTTTGTAACAACAGCTTAA
CAAGCTGGAGTATACGTAGGTAAAGAAGGGTAATAATAGGGGATTTTAAAAAAAAAGACG
AATAATAACTATTTTACTAATACAAACTAATTATTCAATACCTAAAACTAGCTCACCTTC
ATTGCTGATAAAACAAAATCTGTAGAATTAAATGAAAATAATATCTAACAAGATGAAAAA
AACAACCTTAATAATTCCAGTAGTAAAATTAATAAAATTTTACTTCCAGACAGAAGTGAA
ATCACAAACAAAATAAATGGTGCTGAAATAAATCAATTTGTAGCTTCAGACAACAAAAAA
GTAAATTTTTAGACATTATCCTAATAGCCAGCTTCTTCAAAAGTAAGAAGTAGGAAAGTG
GGAAGCAGTAGCTTAAATAATGAGGTTATCAGTGGTAAAGAAATTTCAATTCTAGATAAA
AAAGCTCTCACAAAAATAACAAAAGTAAACACTGAAAGAAACAGTATTATTTAACCTGAG
AGAAGTATGGATGATCATTATAATAAATTGCCACGTTGCTATGAGCATTCAAAAAGAATT
AAAGAACTGTATTGTGTAGATGATAATTGTTAAGTGAAAAATAAATTTGGATGTGTTCTC
TGTTTTAGCTCTGTCAACGGATCACCTCACAGTTTCCATGAATATTACACAATTTCCTCA
GAAGAAGATTTACAAGCTAAAATAAATAGAAATAGATAAGATTTTATTCAATTTATTTAA
GATAAGATTCAATTCAAGTGCCAAGATAAGAAATCTTAATTTTATATGTATTAAGATTAA
ATCACAGAATCTTTAATTAATTATGCTGATTCTATACAGGATAGGCTATTTATAGGATTT
GAGGCAGAAGAAATACAAAAATTTTAGCTCCCTCTTTTGTAGGGAAGTATTGAAAGAAAG
AGTCCAGCAAAAAAATCAAAGCGAAATTCTAAAGAAAATAGGGAAGAATTCGATGAAAAA
GAATTATCAATAATCTTGTACATAGACCTACTTGAGAAATAATTGAATAAAAAAATAGAA
AATTAGAATAAAATATGGCTACAACAAATCTATCTTGGTGAAAAAAATGAAGAATTTTTA
AAGGAAAAGAAATGTAAATTAATTATAGCTGGTAAATGCTTTAGCAATCTTAGTGATCAA
ATATTAAAATTATACTTAACTAGTGAGCAGGTTAATTATGATTTATAAGAACTAGAAAAC
AACAAATCATAGCTGTATTATATAAATGATGAAAATAGTGATGGTATTTATTAATTAGAT
GATGATAAAGTAAAATAAGGAAGAGGAATTTAATTTTTTAAGAGTGGAGGTTTATATGAA
GGGTATTTTAAAAATAATTAAAAGCATGGAAAAGGGAAACTAATTACATTTGAAGGAGAT
GTTTACATAGGAGAATTTCAAAAAAACATGAAAAGAGGAAGAGGTGTATTAACCTACTCG
AATAAAGATATATATGATGGAGAATTTTATTAAGACACATGTCACGGAATTGGAAAAATG
AGTTATGCTAAAGACTAAGTTGTATATATAGGTGGATGGAATAAAAATTAAAGGCATGGA
AAAGGATAAATTTTTAAAGACAATGAACTAATATTCTCAGGCGTATATATAGGAGACAAC
CCTAAGGCTAATAGTAAAGAATGA


>TTHERM_00149910(protein)
MSQQSQVSNKNNFRRRTINSQQLEFQSPEKESNANDQPKLSQDSICEQQEQQISVNLSID
NSLQSNSQKDDQGIITPKKDKILVQSFTDALIQQNNQQNNKQLISKNFLSPTSSQSSNKS
RSSLSSPIQIRINPNQYQISNNTARRSLNYEISQIQEKRLEDEKTAISYAEKVLQSRNFL
SQQKSKQENQRYSLFVTTAQQAGVYVGKEGQQQGILKKKTNNNYFTNTNQLFNTQNQLTF
IADKTKSVELNENNIQQDEKNNLNNSSSKINKILLPDRSEITNKINGAEINQFVASDNKK
VNFQTLSQQPASSKVRSRKVGSSSLNNEVISGKEISILDKKALTKITKVNTERNSIIQPE
RSMDDHYNKLPRCYEHSKRIKELYCVDDNCQVKNKFGCVLCFSSVNGSPHSFHEYYTISS
EEDLQAKINRNRQDFIQFIQDKIQFKCQDKKSQFYMYQDQITESLINYADSIQDRLFIGF
EAEEIQKFQLPLLQGSIERKSPAKKSKRNSKENREEFDEKELSIILYIDLLEKQLNKKIE
NQNKIWLQQIYLGEKNEEFLKEKKCKLIIAGKCFSNLSDQILKLYLTSEQVNYDLQELEN
NKSQLYYINDENSDGIYQLDDDKVKQGRGIQFFKSGGLYEGYFKNNQKHGKGKLITFEGD
VYIGEFQKNMKRGRGVLTYSNKDIYDGEFYQDTCHGIGKMSYAKDQVVYIGGWNKNQRHG
KGQIFKDNELIFSGVYIGDNPKANSKE