Identifiers and Description

Gene Model Identifier

TTHERM_00151420

Standard Name

GST25 (Glutathione S-transferase mu 25, TtGSTm25, GSTm25)

Aliases

PreTt20803 | 12.m00477 | 3700.m00197

Description

GST25 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05100.1 1.9994050701445255e-104
Description: glutathione S-transferase domain-containing protein (203 aa)
Oxytricha Contig16299.0.g15 9.99967697349061e-30
Description: Glutathione S-transferase, N-terminal domain
WormBase WBGene00021127 0.00010003404299092957
Description: status:Confirmed UniProt:O45010 protein_id:CCD73396.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151420(coding)
ATGATTCTAGGCTATTGGGAAATACCAGGAAAGTGCTAAGCTATCAGATTTCTTTTAGAA
ATTTTGAAGGTTGAATACACCGAAAAGAGATATACTTTTAAAAATTCAAGAGAATGGTTT
GAAGAAGATAAGTTGAAAATTGGATTAGATTTCCCTAATCTGCCTTATTTTATAGATGGA
AACATCAAGTTATCTGAAAGCAATTCTATAGTAACCTACATTCTTGATAAATATAGCAAA
TAAGAATGGAAAGGTAAAAACGAAGACATATATAAAGTTGACGAACTACGATTCCTTTTT
ACAGATTTGTAGAGCTTAGGATATTTATCAAGCAAAGGAGACTAAGATGCTTTTAAAAAT
TATTTAAAAAAACTAGATTTTGTTTATTAATTTATTAAAGGTGAAAGTAAATTTTTGCTA
GGATATTTTACAATAGCTGATTTATATTCATGGGAATGTATAACAAGACTTAAAGTTTAA
TGGCCAGAATATTATTAAAAGTATTCTGATAAATTTGATCAACTCATTTAAAATATTGAG
AATATTCCTGAGTTATATTCATACATATAGTCTGATAGATGTCTTAAAATTTAACCTCTA
AAAAAATGA


>TTHERM_00151420(gene)
ATGATTCTAGGCTATTGGGAAATACCAGGAAAGTGCTAAGCTATCAGATTTCTTTTAGAA
ATTTTGAAGGTTGAATACACCGAAAAGAGATATACTTTTAAAAATTCAAGAGAATGGTTT
GAAGAAGATAAGTTGAAAATTGGATTAGATTTCCCTAATCTGCCTTATTTTATAGATGGA
AACATCAAGTTATCTGAAAGCAATTCTATAGTAACCTACATTCTTGATAAATATAGCAAA
TAAGAATGGAAAGGTAAAAACGAAGACATATATAAAGTTGACGAACTACGATTCCTTTTT
ACAGATTTGTAGAGCTTAGGATATTTATCAAGCAAAGGAGACTAAGATGCTTTTAAAAAT
TATTTAAAAAAACTAGATTTTGTTTATTAATTTATTAAAGGTGAAAGTAAATTTTTGCTA
GGATATTTTACAATAGCTGATTTATATTCATGGGAATGTATAACAAGACTTAAAGTTTAA
TGGCCAGAATATTATTAAAAGTATTCTGATAAATTTGATCAACTCATTTAAAATATTGAG
AATATTCCTGAGTTATATTCATACATATAGTCTGATAGATGTCTTAAAATTTAACCTCTA
AAAAAATGA


>TTHERM_00151420(protein)
MILGYWEIPGKCQAIRFLLEILKVEYTEKRYTFKNSREWFEEDKLKIGLDFPNLPYFIDG
NIKLSESNSIVTYILDKYSKQEWKGKNEDIYKVDELRFLFTDLQSLGYLSSKGDQDAFKN
YLKKLDFVYQFIKGESKFLLGYFTIADLYSWECITRLKVQWPEYYQKYSDKFDQLIQNIE
NIPELYSYIQSDRCLKIQPLKK