Identifiers and Description

Gene Model Identifier

TTHERM_00151480

Standard Name

NRK20 (NIMA-Related Kinase )

Aliases

PreTt20809 | 12.m00483 | 3700.m00203

Description

NRK20 kinase domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05104.1 7.997133821356313e-142
Description: hypothetical protein (1234 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00151480(coding)
ATGTGGTAATTAATTCATTAAATTAAGTAGACTTTAAAAAAGTAAAAGAAAAATAAAAAA
AGTAAAAAATATTTAAAGCTCTAATTGAATCGATTTATTATCTATTTGATTATGGAAAAA
AAAGATAAAGATATAGTCAGAGGATGCTAAAAATTTAAAGAAAAATTTAAATACTATAGT
AATAGCGATAAAGAAGCTATCATTTTCTTAAAATTGAGAAATGAAGGATGTCCCAGAAAG
CCTGCCCTCAGGTTTAGTTCTAAAACTGTATGCAAATCAGACTCTACTCGTACTATATTT
GGTCCTCGAAATCACAGGATACTCTAGGTTCAGCAACTACCTAGTTATTCACTTTAAAAT
GGATGGTTCTAAGGAAATCTATACTATAATATGGACAATGAATTCAAGCTGAGTTATAAG
GATATACTGCAGGAAGATATTTAAGATGATAACTTGAAAGTTTTATTTAACAAAAATGAA
GAATAAGCTAAAGAATAATTTAAGAAAATGTTATAAATCACTAAATAGTATTTTGATGAA
ATATCTTAGATATGCACTATTAATAGAGGAAATTCTAAAGAAGAATATTTAAAGAGTATT
CAAAATTTTATTTAGAACACACGCAAGCAACTTAAAACGCAAACATATTTTGAATACAAG
AATATAAAGTTTTATTATTTGTCTAGTATGTTATAATCTATTTTGGATAATGAAAAGAAA
TCTTCTGAAGAAATAGAGAGCATAATATAAAAGTACAATGTATTCAACGATGTTTTAAGA
TAGCCAGATATTAAAAGTTTAGATATCAAGTAAGAAGACAATAAGAATAAAGAATAATCT
TAATAACTAATGTCTCCAAGCTCAAAGTCTGGAAAGAATCTATTTGGATTGAGAAAGTAA
AATAACTAAAGCTCAAAGGAAAAATTACTAAATACAAGCTTAAGTGATAATAGCATGATG
ATGACTCTCAAAAGCTCACCAAAAGTGGGACTGCTATAAGGGTCATCAGATGATATTAAT
CTTCCTGATTTAACTTTGTAAAATTCTTCACATTAACAAACATCTATAGGACCTTTTGAC
TATATGTCAAGTGATTCAATAAATAGCTAAGAGCGTATACAAAGCTAAGAAGATAAATCT
GTTTATGGAGATGGTGATATGTCACCTAAGAGTTCTACGTATACTGATTCCTCATTTAAA
AAGTCAAACATTAGTTTCATAAATAGTGCAGCTCAGCAGCTAAAGCTACTACAATAAATG
GATCAAACTAATTAAGACTTGTTCTCCAATACTCCATTGACTAAACTAGAAAGAGTATAA
TTCATAGAAGGTTCAGCTGAAAGTAAAAGGTTACTTGAGTAATAATTTAATGATGCATAA
TATTTTTATTAATATTAATAGCAAAATAATAAATCATTTGATAACAAAAATCAAAATAAT
CAAAATAAAAAAAAAGATGTAAAGAGTAAAGCTAAAATATATACAAATGAAAATGTTAGC
AGTAAAAATAAGTAAATTAGAAAATTTTAAAGCTTATTAAAGGTAGATGCTGATTTAGAG
AAAGAATTCTTAAAATTAGCCTAGTGTGAATAATATCAAATAAAACCTGAAGATATTTAA
AAATAAAATAATTTTTAAAATTAAAAGCAATTAGAAATTTAGTAACAACCTCCTTCTCCA
AATACTTAAAAAATGAGTCTTTTTCAAAAGGATTTTGTTGAATCGTCTAAAAACATAGAA
AGAAGTAGCAGAAACAAGGAAGAAAAAATCATGTTTTCACCTACAAAAAGTTCATAACAT
ATTAATAGTAGTTAATAGAAAATAGATGTTTTGAATAAAACAGATAGTTTTAATCTATAA
AAGCTTGTTGAAAAAAAAAAATAAATGTTAGCTGCTTTTAGGAAGAGAAATTATAAGAAT
TTAAGCAACTAGTTTCCTTTAAATTAAGAAGCAATTAAAGCTCCTTCAAACATATACTTT
TAAATTCTTCAATCAAAACCTGATAAATTCTCTCATTAAAGAAATCAAACATACTCAAAT
GATACAAATTCATTATTGTAAACTGCTAAGGTTGAAAATAATTTTCCTGTGTAAAATAAA
TTCCCTTAAAAATATATTTAAGAAAATGAGAATTACTTTACAATGAAGAACAAATATCAA
GCAAAAAAACATTAAAAATCTCAATAAACTTAGGTTTCAGTAACTAGTACAAAAAATAAT
TTTAACAAATCAACAAATGATGAAACATAGAAAGATTGTGTAAAGGACTAAAGAGTCAAA
ACTCAATCAAGTTATTTTTTATATAAAAAGTAAGAATAGCAAAGTAGTTATATCACAAAT
AGTTAGAGACTGTCTTTATCTATTAAGTCTAATATGAATAAGACATAAAATATTTTTGAA
AATTTAGAAAGAGCAAGAAAACCAAAAATTGATAATTTTTTCAATTAAAAAAAATGA


>TTHERM_00151480(gene)
ATGTGGTAATTAATTCATTAAATTAAGTAGACTTTAAAAAAGTAAAAGAAAAATAAAAAA
AGTAAAAAATATTTAAAGCTCTAATTGAATCGATTTATTATCTATTTGATTATGGAAAAA
AAAGATAAAGATATAGTCAGAGGATGCTAAAAATTTAAAGAAAAATTTAAATACTATAGT
AATAGCGATAAAGAAGCTATCATTTTCTTAAAATTGAGAAATGAAGGATGTCCCAGAAAG
CCTGCCCTCAGGTTTAGTTCTAAAACTGTATGCAAATCAGACTCTACTCGTACTATATTT
GGTCCTCGAAATCACAGGATACTCTAGGTTCAGCAACTACCTAGTTATTCACTTTAAAAT
GGATGGTTCTAAGGAAATCTATACTATAATATGGGTAAGTTTTTTATTCAATTAAAGGCA
AAAATTAGACAAAAAAGTTAAGTAGAACATTTATGATTAAATATAAATAAATGCTTTATT
AATGAAAAAATTTTACAATTTTATTTGATATTATAACGAAATAGACAATGAATTCAAGCT
GAGTTATAAGGATATACTGCAGGAAGATATTTAAGATGATAACTTGAAAGTTTTATTTAA
CAAAAATGAAGAATAAGCTAAAGAATAATTTAAGAAAATGTTATAAATCACTAAATAGTA
TTTTGATGAAATATCTTAGATATGCACTATTAATAGAGGAAATTCTAAAGAAGAATATTT
AAAGAGTATTCAAAATTTTATTTAGAACACACGCAAGCAACTTAAAACGCAAACATATTT
TGAATACAAGAATATAAAGTAAAGCTTTCTTATATTTTTTAGCTCGGATGGATGGTTTAT
CAATTTTTTTTAAAAAGGTTTTATTATTTGTCTAGTATGTTATAATCTATTTTGGATAAT
GAAAAGAAATCTTCTGAAGAAATAGAGAGCATAATATAAAAGTACAATGTATTCAACGAT
GTTTTAAGATAGCCAGATATTAAAAGTTTAGATATCAAGTAAGAAGACAATAAGAATAAA
GAATAATCTTAATAACTAATGTCTCCAAGCTCAAAGTCTGGAAAGAATCTATTTGGATTG
AGAAAGTAAAATAACTAAAGCTCAAAGGAAAAATTACTAAATACAAGCTTAAGTGATAAT
AGCATGATGATGGTAATATATCAAAATATATACATAGATTATTTTTAAATATTTATTTAA
ATTTATTAATAGACTCTCAAAAGCTCACCAAAAGTGGGACTGCTATAAGGGTCATCAGAT
GATATTAATCTTCCTGATTTAACTTTGTAAAATTCTTCACATTAACAAACATCTATAGGA
CCTTTTGACTATATGTCAAGTGATTCAATAAATAGCTAAGAGCGTATACAAAGCTAAGAA
GATAAATCTGTTTATGGAGATGGTGATATGTCACCTAAGAGTTCTACGTATACTGATTCC
TCATTTAAAAAGTCAAACATTAGTTTCATAAATAGTGCAGCTCAGCAGCTAAAGCTACTA
CAATAAATGGATCAAACTAATTAAGACTTGTTCTCCAATACTCCATTGACTAAACTAGAA
AGAGTATAATTCATAGAAGGTTCAGCTGAAAGTAAAAGGTTACTTGAGTAATAATTTAAT
GATGCATAATATTTTTATTAATATTAATAGCAAAATAATAAATCATTTGATAACAAAAAT
CAAAATAATCAAAATAAAAAAAAAGATGTAAAGAGTAAAGCTAAAATATATACAAATGAA
AATGTTAGCAGTAAAAATAAGTAAATTAGAAAATTTTAAAGCTTATTAAAGGTAGATGCT
GATTTAGAGAAAGAATTCTTAAAATTAGCCTAGTGTGAATAATATCAAATAAAACCTGAA
GATATTTAAAAATAAAATAATTTTTAAAATTAAAAGCAATTAGAAATTTAGTAACAACCT
CCTTCTCCAAATACTTAAAAAATGAGTCTTTTTCAAAAGGATTTTGTTGAATCGTCTAAA
AACATAGAAAGAAGTAGCAGAAACAAGGAAGAAAAAATCATGTTTTCACCTACAAAAAGT
TCATAACATATTAATAGTAGTTAATAGAAAATAGATGTTTTGAATAAAACAGATAGTTTT
AATCTATAAAAGCTTGTTGAAAAAAAAAAATAAATGTTAGCTGCTTTTAGGAAGAGAAAT
TATAAGAATTTAAGCAACTAGTTTCCTTTAAATTAAGAAGCAATTAAAGCTCCTTCAAAC
ATATACTTTTAAATTCTTCAATCAAAACCTGATAAATTCTCTCATTAAAGAAATCAAACA
TACTCAAATGATACAAATTCATTATTGTAAACTGCTAAGGTTGAAAATAATTTTCCTGTG
TAAAATAAATTCCCTTAAAAATATATTTAAGAAAATGAGAATTACTTTACAATGAAGAAC
AAATATCAAGCAAAAAAACATTAAAAGTAATTACTATTAAATATATATATTATTTATAAA
TAATAAATATAAATTATATAAAATAGATCTCAATAAACTTAGGTTTCAGTAACTAGTACA
AAAAATAATTTTAACAAATCAACAAATGATGAAACATAGAAAGATTGTGTAAAGGACTAA
AGAGTCAAAACTCAATCAAGTTATTTTTTATATAAAAAGTAAGAATAGCAAAGTAGTTAT
ATCACAAATAGTTAGAGACTGTCTTTATCTATTAAGTCTAATATGAATAAGACATAAAAT
ATTTTTGAAAATTTAGAAAGAGCAAGAAAACCAAAAATTGATAATTTTTTCAATTAAAAA
AAATGA


>TTHERM_00151480(protein)
MWQLIHQIKQTLKKQKKNKKSKKYLKLQLNRFIIYLIMEKKDKDIVRGCQKFKEKFKYYS
NSDKEAIIFLKLRNEGCPRKPALRFSSKTVCKSDSTRTIFGPRNHRILQVQQLPSYSLQN
GWFQGNLYYNMDNEFKLSYKDILQEDIQDDNLKVLFNKNEEQAKEQFKKMLQITKQYFDE
ISQICTINRGNSKEEYLKSIQNFIQNTRKQLKTQTYFEYKNIKFYYLSSMLQSILDNEKK
SSEEIESIIQKYNVFNDVLRQPDIKSLDIKQEDNKNKEQSQQLMSPSSKSGKNLFGLRKQ
NNQSSKEKLLNTSLSDNSMMMTLKSSPKVGLLQGSSDDINLPDLTLQNSSHQQTSIGPFD
YMSSDSINSQERIQSQEDKSVYGDGDMSPKSSTYTDSSFKKSNISFINSAAQQLKLLQQM
DQTNQDLFSNTPLTKLERVQFIEGSAESKRLLEQQFNDAQYFYQYQQQNNKSFDNKNQNN
QNKKKDVKSKAKIYTNENVSSKNKQIRKFQSLLKVDADLEKEFLKLAQCEQYQIKPEDIQ
KQNNFQNQKQLEIQQQPPSPNTQKMSLFQKDFVESSKNIERSSRNKEEKIMFSPTKSSQH
INSSQQKIDVLNKTDSFNLQKLVEKKKQMLAAFRKRNYKNLSNQFPLNQEAIKAPSNIYF
QILQSKPDKFSHQRNQTYSNDTNSLLQTAKVENNFPVQNKFPQKYIQENENYFTMKNKYQ
AKKHQKSQQTQVSVTSTKNNFNKSTNDETQKDCVKDQRVKTQSSYFLYKKQEQQSSYITN
SQRLSLSIKSNMNKTQNIFENLERARKPKIDNFFNQKK