Identifiers and Description

Gene Model Identifier

TTHERM_00151600

Standard Name

TGS1 (Trimethyl Guanosine Synthase 1)

Aliases

PreTt20818 | 12.m00492 | 3700.m00212

Description

TGS1 RNA cap guanine-N2 methyltransferase; Trimethyl guanosine synthase; responsible enzyme for hypermethylation of guanosine 5' caps

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08241 ) methyltransferase domain
  • ( PF08242 ) methyltransferase domain
  • ( TIGR00675 ) DNA (cytosine-5-)-methyltransferase
  • ( TIGR02072 ) biotin biosynthesis protein BioC

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05114.1 9.997093137033517e-262
Description: hypothetical protein (720 aa)
DictyBase DDB_G0288547 0.00000000000007997998332353294
Description: DDB_G0288547 on chromosome: 5 position 1676407 to 1677541
Oxytricha Contig19029.0.g57 0.000000000800327577657144
Description: RNA cap guanine-N2 methyltransferase
SGD YPL157W 0.000000100009565553302
Description: TGS1 Trimethyl guanosine synthase, conserved nucleolar methyl transferase that converts the m(7)G cap structure of snRNAs, snoRNAs, and telomerase TLC1 RNA to m(2,2,7)G; also required for nucleolar assembly and splicing of meiotic pre-mRNAs
WormBase WBGene00011631 0.0000009995106777214876
Description: status:Confirmed UniProt:A8WHU4 protein_id:CAP19342.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151600(coding)
ATGTTTAATTGCTGTTTAAAGAATAATTAAAAGCATGACGATGATGATAACGGCAATAAA
AAAAAGGATAAAAGGCTAAAAAGTTAAATAAATATGAAGACAATCAACACTAATGATGAA
TCTATCTCTTAATTATAAGATACAAAACATTATACAAATAATTTAACAGTAACAAAGACA
GATATTTAGAATAATATGAATGCTAATACAGGAATACATAATTAATAAGGGTATATATCT
GAAAAAAGTATACTCTCTCATTTGAATAGTGAGAAGAAAAACCATAGAGACACAGTAGAA
ACACATAATAACAATAACAACAATTATAATAGCTTTTTTACTTCTGGTATGAATACTCCT
AATTATGACTATAATTTCAAAGGTTAAGATATCAATTAATCTGATAAAAAAGGCAATTAG
TAAGTAGCAACTGAGAAGGATAAAACAATTGCTTGTTCTTTAGATGCGAGTAATTTAGAG
CATTTTTAAAAAATTTTTGAAAAGAAGTAGGTAAAAGATTAGTAATTCGTGTAGCAAATA
GACCAGTAAGTAAAGCAAAGGTTTCTTTTGAATAAATTCTTTTTTTTGAGAGACTAAGGA
AATAAGTATGTTACTCTTGCTTATTGCAGTTATTAAGCTTTTTATGTTAATGGCGGGACA
TTTAATTATTCATTAGCGTCAAATAAGAGTACATAAAGTATCTTAAATAACACTAGTTTA
TTATTCAAAGCAGCTCCTAATTAGAATTTAAATGTTTCAAAGCAAATAAATACAAGCTAA
GATAGTATAAATTCTTAAAACAATTCTACTATCTTTACTACTAGTAAAGTACAAAATAAC
AATGTTGATTTTTTAAACTACTAAAGTCTATATGCAAAATTTAAAGTAGATATGGATTAG
ACTGAAAATTTCACACCTTAAAAAATAGCATTTCATATTGCCTAAAAATTTAAAAAATAC
CCTATCTTAATAGACGCCTGCTGTGGTATTGGAGGAAATACTGTGCAATTTTCCAAAATC
AATAAATTTGTTTTTGCTGTTGACTAGAGCTATAGAGCTATTAAAACATGCAATGAAAAC
ATAAAAAACCACAAATAAGATGTCTCAAATGTAGAATTCATTTAAGCAGATTTTTTATCA
TTAGAGTGTGGCGAGCTAGGCTAATTAAGAGCTGATATTGTATTCATAAATCCACAGATA
GATATGATTTCTGAAACAACAAAACCTGATATCTTTAAGCATTCTTCTCCTAATCTCTTA
AAAGCAATGAAAAATGCATACAGAATGTCAAAAAACATAGCTATTCTACTACCCTATTAC
ATAGATATAAACCAAATTCCTATATTATTGGATAAGTTTTATAGAATCTACAGAAATTTT
CCTTTAGACATGATTTAACATCACTGCCCTCACATAGAGATTATTTATATGAATGGAAAA
ATTAAGTATTTCTTGATTTTATTAGGTGACGCATCTAAGATATCTTAAGAAGATGAAATT
AAATTTCTCCAAGAGTACATATTAGATAATAGTCCATATAAAGGACCTTATGAAGAAAAA
GTGTTAGAGTTGTTAAATACTATATTAAGGAAAGTAGGTATGTTTAAATTAATTAGATGT
TTAGCTAAATCAATTGATATCAATGATCTTTAGAAGTAAAAAAATTTACTAAATTCTTTT
AGTGATGAATTAGAAAAAGAGGGCATTATCCATCAAAAAGAAATCAAAAATATGTTAAAT
TTAACAAACAATATTTCAAATGTTTGTGAAAGTGCTTCTGACTTAGTAGGGTCTCCAAAC
TAATTTCCAAACAGTTTCACATCTTAATAAAGCTTTTAGTTAAATGTTTAATAAGGTTCT
CTTGTATAATCTTAGGAATTAAATTAATAGTTACCAAAAGCTACTAGCTCAAAGTAAATA
TCATTTGATAAGGATTCATAAAGCAACTCATTTTATGGAGGAGGAGTAGAAAGCAGTCTC
GGAGATTTGTTAGAAAAAAAAGATAGCTTAAGTGAAAATGATATTTCTGATAATTACTCC
AATAATGAAAGTGATTTCTATTTCGATGAATATAATAACATTCCAATAGATGGAAATAAA
ATTAATTTAAATGTAAATAATCAAATAAAGTCAATTTGA


>TTHERM_00151600(gene)
ATGTTTAATTGCTGTTTAAAGAATAATTAAAAGCATGACGATGATGATAACGGCAATAAA
AAAAAGGATAAAAGGCTAAAAAGTTAAATAAATATGAAGACAATCAACACTAATGATGAA
TCTATCTCTTAATTATAAGATACAAAACATTATACAAATAATTTAACAGTAACAAAGACA
GATATTTAGAATAATATGAATGCTAATACAGGAATACATAATTAATAAGGGTATATATCT
GAAAAAAGTATACTCTCTCATTTGAATAGTGAGAAGAAAAACCATAGAGACACAGTAGAA
ACACATAATAACAATAACAACAATTATAATAGCTTTTTTACTTCTGGTATGAATACTCCT
AATTATGACTATAATTTCAAAGGTTAAGATATCAATTAATCTGATAAAAAAGGCAATTAG
TAAGTAGCAACTGAGAAGGATAAAACAATTGCTTGTTCTTTAGATGCGAGTAATTTAGAG
CATTTTTAAAAAATTTTTGAAAAGAAGTAGGTAAAAGATTAGTAATTCGTGTAGCAAATA
GACCAGTAAGTAAAGCAAAGGTTTCTTTTGAATAAATTCTTTTTTTTGAGAGACTAAGGA
AATAAGTATGTTACTCTTGCTTATTGCAGTTATTAAGCTTTTTATGTTAATGGCGGGACA
TTTAATTATTCATTAGCGTCAAATAAGAGTACATAAAGTATCTTAAATAACACTAGTTTA
TTATTCAAAGCAGCTCCTAATTAGAATTTAAATGTTTCAAAGCAAATAAATACAAGCTAA
GATAGTATAAATTCTTAAAACAATTCTACTATCTTTACTACTAGTAAAGTACAAAATAAC
AATGTTGATTTTTTAAACTACTAAAGTCTATATGCAAAATTTAAAGTAGATATGGATTAG
ACTGAAAATTTCACACCTTAAAAAATAGCATTTCATATTGCCTAAAAATTTAAAAAATAC
CCTATCTTAATAGACGCCTGCTGTGGTATTGGAGGAAATACTGTGCAAGTAATACTTAAA
TATAACAATCAAAAATTTACAATTTATTTTTCAATAACATTTTAATAATTTTACAATTTT
TTATTTAATAAAAATAGTTTTCCAAAATCAATAAATTTGTTTTTGCTGTTGACTAGAGCT
ATAGAGCTATTAAAACATGCAATGAAAACATAAAAAACCACAAATAAGATGTCTCAAATG
TAGAATTCATTTAAGCAGATTTTTTATCATTAGAGTGTGGCGAGCTAGGCTAATTAAGAG
CTGATATTGTATTCATAAATCCACAGATAGATATGATTTCTGAAACAACAAAACCTGATA
TCTTTAAGCATTCTTCTCCTAATCTCTTAAAAGCAATGAAAAATGCATACAGAATGTCAA
AAAACATAGCTATTCTACTACCCTATTACATAGATATAAACCAAATTCCTATATTATTGG
ATAAGTTTTATAGAATCTACAGAAATTTTCCTTTGTAAATTTAAGAATTTTAATTTTCCA
AAATACTTATTTATTTGAATTAAAAAAATAATATTTTTGTAGAGACATGATTTAACATCA
CTGCCCTCACATAGAGATTATTTATATGAATGGAAAAATTAAGTATTTCTTGATTTTATT
AGGTGACGCATCTAAGGTTATTTAATTTATATTTTTAATTTATATGAATTTGTTAAATTA
ATTTTTAAAAAATAGATATCTTAAGAAGATGAAATTAAATTTCTCCAAGAGTACATATTA
GATAATAGTCCATATAAAGGACCTTATGAAGAAAAAGTGTTAGAGTTGTTAAATACTATA
TTAAGGAAAGTAGGTATGTTTAAATTAATTAGATGTTTAGCTAAATCAATTGATATCAAT
GATCTTTAGAAGTAAAAAAATTTACTAAATTCTTTTAGTGATGAATTAGAAAAAGAGGGC
ATTATCCATCAAAAAGAAATCAAAAATATGTTAAATTTAACAAACAATATTTCAAATGTT
TGTGAAAGTGCTTCTGACTTAGTAGGGTCTCCAAACTAATTTCCAAACAGTTTCACATCT
TAATAAAGCTTTTAGTTAAATGTTTAATAAGGTTCTCTTGTATAATCTTAGGAATTAAAT
TAATAGTTACCAAAAGCTACTAGCTCAAAGTAAATATCATTTGATAAGGATTCATAAAGC
AACTCATTTTATGGAGGAGGAGTAGAAAGCAGTCTCGGAGATTTGTTAGAAAAAAAAGAT
AGCTTAAGTGAAAATGATATTTCTGATAATTACTCCAATAATGAAAGTGATTTCTATTTC
GATGAATATAATAACATTCCAATAGATGGAAATAAAATTAATTTAAATGTAAATAATCAA
ATAAAGTCAATTTGA


>TTHERM_00151600(protein)
MFNCCLKNNQKHDDDDNGNKKKDKRLKSQINMKTINTNDESISQLQDTKHYTNNLTVTKT
DIQNNMNANTGIHNQQGYISEKSILSHLNSEKKNHRDTVETHNNNNNNYNSFFTSGMNTP
NYDYNFKGQDINQSDKKGNQQVATEKDKTIACSLDASNLEHFQKIFEKKQVKDQQFVQQI
DQQVKQRFLLNKFFFLRDQGNKYVTLAYCSYQAFYVNGGTFNYSLASNKSTQSILNNTSL
LFKAAPNQNLNVSKQINTSQDSINSQNNSTIFTTSKVQNNNVDFLNYQSLYAKFKVDMDQ
TENFTPQKIAFHIAQKFKKYPILIDACCGIGGNTVQFSKINKFVFAVDQSYRAIKTCNEN
IKNHKQDVSNVEFIQADFLSLECGELGQLRADIVFINPQIDMISETTKPDIFKHSSPNLL
KAMKNAYRMSKNIAILLPYYIDINQIPILLDKFYRIYRNFPLDMIQHHCPHIEIIYMNGK
IKYFLILLGDASKISQEDEIKFLQEYILDNSPYKGPYEEKVLELLNTILRKVGMFKLIRC
LAKSIDINDLQKQKNLLNSFSDELEKEGIIHQKEIKNMLNLTNNISNVCESASDLVGSPN
QFPNSFTSQQSFQLNVQQGSLVQSQELNQQLPKATSSKQISFDKDSQSNSFYGGGVESSL
GDLLEKKDSLSENDISDNYSNNESDFYFDEYNNIPIDGNKINLNVNNQIKSI