Identifiers and Description

Gene Model Identifier

TTHERM_00151990

Standard Name

BBC42

Aliases

PreTt20857 | 12.m00531 | 3700.m00250

Description

BBC42 dioxygenase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05147.1 9.997093137033517e-262
Description: hypothetical protein (380 aa)
DictyBase DDB_G0276279 9.999888128184441e-42
Description: DDB_G0276279 on chromosome: 2 position 6610188 to 6611499
Oxytricha Contig18648.0.g62 1.9991517704232713e-32
Description: 2OG-Fe(II) oxygenase superfamily
Stentor Coeruleus SteCoe_5895 5.900090541597061e-29
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151990(coding)
ATGTTGTGCATTTTGAACAGGGGATTAAAGTTAAAAATGACTTAAATGAAAAGACTTGCT
TACTATAGCACTGAGTAAGTAAGCTTTGATTTCAATGAAATTTTAGATGAAAATCTTGAT
TTGAATGAGCGTATTAAAACTGCATTTGGACCTGAAGGAACTGGTATTTGCACTATTAAA
AATGTCCCTAATTACAAAAGAGCAAGATAAAATCTTCTTAATTTAAGCTATCAACTCGCT
AATCTTCCTTAAGAAGAAAAAGCTAAGTTAGATAGACCTGAAGTTAAATGGTCTAGAGGT
TGGTAAGAAAGTAAAGAGCATTTTGGTAATAAGAATGACAAATTGAAAAGCGCTTTTATT
GCACTCCCACTTAGAGAGGAAGAAACTCATTTGACCTAAACTTAATAGCAAGTTCTTGGA
GATGCAGCTTCAAAGTTATACTAAAGTGGAAATGTATGGCCCGAAGGCCCTCTTCCTACT
TTTAAGCCTCACTTTAAACTTTTAAGTAATATTATGGTTGATACCTCATTCCTTTTAGCT
AAGCATATTGATAAGTATGTGAGTCAAGTTATGACTTCTTATAAAAGAGATACTCTTTAT
AACTTGATTAAGAATAATAAAGATCATGTAGGTAGACTTAATTATTACAAATCCTCTACT
GATCCTATTACTCGTGAGGATGATTGGAATTCTTGGCACACAGATTATTCTGCTCTTTCA
GCTCTTACTCCTGCTATATACATCACCCATGATGGCTATCCTGTAACTTTTGATGATAGA
AAGACTGGACTTTTCTTTAAAAATAGATGGGGTGAAAAAGAACATATTAGTGCTGATAAA
GACTCTATTATTTTCTAAATTGGTGAATCTATGTAAATTTTATCTGGTGGTGTGTTAGAA
GCTACCCCTTATTGTGTCTCACGTTCCAAAAAATCATAAGATCTTGGATTAAATCGTGCT
ACATTCTAACTTTACTTAGTTCCTCCACCTGAATATAAATTATTCACCCCCTCAGGTATT
GATGAAAGATATGCATATGGAAGATAAATAGATCAAGTTCCTCACATTACAAAGCGTTGG
AATTAAGGTATTCCATTTGCAACTTTCTAACAAAAAACTATTTAAGAATATCGTATTTGA


>TTHERM_00151990(gene)
ATGTTGTGCATTTTGAACAGGGGATTAAAGTTAAAAATGACTTAAATGAAAAGACTTGCT
TACTATAGCACTGAGTAAGTAAGCTTTGATTTCAATGAAATTTTAGATGAAAATCTTGAT
TTGAATGAGCGTATTAAAACTGCATTTGGACCTGAAGGAACTGGTATTTGCACTATTAAA
AATGTCCCTAATTACAAAAGAGCAAGATAAAATCTTCTTAATTTAAGCTATCAACTCGCT
AATCTTCCTTAAGAAGAAAAAGCTAAGTTAGATAGACCTGAAGTTAAATGGTCTAGAGGT
TGGTAAGAAAGTAAAGAGCATTTTGGTAATAAGAATGACAAATTGAAAAGCGCTTTTATT
GCACTCCCACTTAGAGAGGAAGAAACTCATTTGACCTAAACTTAATAGCAAGTTCTTGGA
GATGCAGCTTCAAAGTTATACTAAAGTGGAAATGTATGGCCCGAAGGCCCTCTTCCTACT
TTTAAGCCTCACTTTAAACTTTTAAGTAATATTATGGTTGATACCTCATTCCTTTTAGCT
AAGCATATTGATAAGTATGTGAGTCAAGTTATGACTTCTTATAAAAGAGATACTCTTTAT
AACTTGATTAAGAATAATAAAGATCATGTAGGTAGACTTAATTATTACAAATCCTCTACT
GATCCTATTACTCGTGAGGATGATTGGAATTCTTGGCACACAGATTATTCTGCTCTTTCA
GGTAATAAAATTGAATTTTTAAAAAATATTTATTTAGGTGAGAATTACAAAAATAAAAAT
TTAAAATAGACTTTTAAAGATTCTGCATTTTTTTATCTTATTAAGAAATTTTTTAAAATG
TAGAGCATTTTATTCTTTCAAAAAGGGAATAAAATTAAAATGCTAAATAGAATAAAATAT
AGATTTCTAACTTATTTTTATCCAAAATGATGATCGAATTTAAAATAACATAATTTTTTT
GATATTTTTAATATAATTTTTAATTGTAAAAGCTCTTACTCCTGCTATATACATCACCCA
TGATGGCTATCCTGTAACTTTTGATGATAGAAAGACTGGACTTTTCTTTAAAAATAGATG
GGGTGAAAAAGAACATATTAGTGCTGATAAAGACTCTATTATTTTCTAAATTGGTGAATC
TATGTAAATTTTATCTGGTGGTGTGTTAGAAGCTACCCCTTATTGTGTCTCACGTTCCAA
AAAATCATAAGATCTTGGATTAAATCGTGCTACATTCTAACTTTACTTAGTTCCTCCACC
TGAATATAAATTATTCACCCCCTCAGGTATTGATGAAAGATATGCATATGGAAGATAAAT
AGATCAAGTTCCTCACATTACAAAGCGTTGGAATTAAGGTATTCCATTTGCAACTTTCTA
ACAAAAAACTATTTAAGAATATCGTATTTGA


>TTHERM_00151990(protein)
MLCILNRGLKLKMTQMKRLAYYSTEQVSFDFNEILDENLDLNERIKTAFGPEGTGICTIK
NVPNYKRARQNLLNLSYQLANLPQEEKAKLDRPEVKWSRGWQESKEHFGNKNDKLKSAFI
ALPLREEETHLTQTQQQVLGDAASKLYQSGNVWPEGPLPTFKPHFKLLSNIMVDTSFLLA
KHIDKYVSQVMTSYKRDTLYNLIKNNKDHVGRLNYYKSSTDPITREDDWNSWHTDYSALS
ALTPAIYITHDGYPVTFDDRKTGLFFKNRWGEKEHISADKDSIIFQIGESMQILSGGVLE
ATPYCVSRSKKSQDLGLNRATFQLYLVPPPEYKLFTPSGIDERYAYGRQIDQVPHITKRW
NQGIPFATFQQKTIQEYRI