Identifiers and Description

Gene Model Identifier

TTHERM_00152040

Standard Name

LC7A

Aliases

PreTt20862 | 12.m00536 | 3700.m00255

Description

LC7A dynein light chain roadblock-type 2 protein; Light chain subunit of ciliary three-headed outer arm dynein (OAD)- two-headed inner arm dynein (IAD) complex 1- and non-axonemal dynein complex 1

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05152.1 5.999140071902665e-66
Description: dynein light chain 2B, cytoplasmic (106 aa)
Oxytricha Contig16690.0.g70 8.001486403440551e-25
Description: Roadblock/LC7 domain
WormBase WBGene00012004 4.999245259173412e-21
Description: locus:dyrb-1 status:Confirmed UniProt:Q22752 protein_id:CAA90946.1
DictyBase DDB_G0285855 1.999598840915195e-17
Description: dlcC on chromosome: 4 position 3725623 to 3726100

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00152040(coding)
ATGTCTGAAGTTGAAGAAACCCTTAATAGAATCAAAACCCATAAATCAGTTTAAGGAATT
GTTATCGTTAATAATGAAGGTAATATTATCAGAACCACATATGAAGGAGATTAAAAAAGT
TTAGGTGAAAAGATTGCCATTAACATACCTTAATTGGCAGCTAAGGCAAAATCTACTGTC
AGAGATCTTGATGAGAATAATCATTTAGTATTTCTGAGAATTAAATCTGATCGTAACGAA
ATAATGGTTGCCCCTGATAAAGATTTTATGCTTATAGTTGTTTAAGGTAAAAGTGATAAA
AAGGAAGATGCTGATTGA


>TTHERM_00152040(gene)
ATGTCTGAAGTTGAAGAAACCCTTAATAGAATCAAAACCCATAAATCAGTTTAAGGAATT
GTTATCGTTAATAATGAAGGTAATATTATCAGAACCACATATGAAGGAGATTAAAAAAGT
TTAGGTGAAAAGATTGCCATTAACATACCTTAATTGGCAGCTAAGGCAAAATCTACTGTC
AGAGATCTTGATGAGAATAATCATTTAGTATTTCTGAGAATTAAATCTGATCGTAACGAA
ATAATGGTTGCCCCTGATAAAGATTTTATGCTTATAGTTGTTTAAGGTAAAAGTGATAAA
AAGGAAGATGCTGATTGA


>TTHERM_00152040(protein)
MSEVEETLNRIKTHKSVQGIVIVNNEGNIIRTTYEGDQKSLGEKIAINIPQLAAKAKSTV
RDLDENNHLVFLRIKSDRNEIMVAPDKDFMLIVVQGKSDKKEDAD