Identifiers and Description

Gene Model Identifier

TTHERM_00152050

Standard Name

TFB2 (RNA polymerase II transcription factor B subunit 2)

Aliases

PreTt20863 | 12.m00537 | 3700.m00256

Description

TFB2 general transcription factor IIH subunit; general transcription factor IIH subunit 2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05153.1 9.997093137033517e-262
Description: transcription factor ssl1 family protein (375 aa)
DictyBase DDB_G0272362 4.998233068678632e-48
Description: gtf2h2 on chromosome: 2 position 1296713 to 1298183
Oxytricha Contig14857.0.g41 9.997441244797434e-45
Description: Ssl1-like
WormBase WBGene00011814 5.000680012816624e-42
Description: General transcription factor IIH subunit 2 status:Confirmed UniProt:P34567 protein_id:CAA83139.3
SGD YLR005W 1.999683289470905e-41
Description: SSL1 Component of the core form of RNA polymerase transcription factor TFIIH, which has both protein kinase and DNA-dependent ATPase/helicase activities and is essential for transcription and nucleotide excision repair; interacts with Tfb4p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00152050(coding)
ATGGATATTGAAGAAGCAGATAGAAGATCAATTATTGATTTCGTAGAATAAAAACTAAAT
ATTAAAGAAGAAAATCCTTTAATACAAACAAAGAAAATCATCGATAAAGGATATACCTCT
ACAACAAAAAAGAGTCTCCTAAGATTTGTATATATTATAGTTGATACAACCTAATCTTCT
ACAAGAGTAGATTTCAAGCCTTCGAGAATAGGACTAACGTAAATCTACTTAAAGAACTTC
ATAAAAAACTTTTTTGATTCTAATCCTTTGAGTGTATTATCTATTGGTAAAACATAAAAT
GGCTAGTGTATAACTCTTTAAGAATTTACATCTAGTATATCTCTTTTAGATAAAACAATC
GAAAAACTTGTAGTTGATGAAAAGGAGGATTTTTCTCTTTTTGAATGTTTAAATGAAACT
TTTAATATTTTTGCTGAAGCACCTCCATATGCTTTCAGAGAAGTAGTTCTAATTTAGTCA
ACACCTTCAACAAAAGATAAAGGTGATATAAATGAATAAATAAATAAAGCCAAATAATGC
AAAATAACTTTTAATATTATATCACTTAATGCAAAAACATTCATATTTTAGAAATTGACA
AAAGAGACATAAGGTAAATATGACACAGCTTTACATGAAAAAGATTATGAAAATTTACTT
AACAGCTATTGTGAACCTCCATAATAAATATTAAATAAAACTGAAAAAACTCTTATACAA
GTTGGTTTCCCTAATAAAAAATATTCTAAAATTTCTGTATTATGTGCTTGCCATATGGAG
TTAAAAACTAACTTTTACATTTGCCCTTAATGCAAAAGTAAAAACTGTGAAGTTCCTTCA
AAATGTTCAGGATGCCAATTAAATTTAATTCTTCCTTTGCATATCACAAAGAGCTATCAT
TTTAGTTAAAATTTAAAAGAATTCGAATTGTTAGGACAAGAAAAATCTAATAATAGTATG
GAAACCGAGTAAGATAAAACATAAAATATCCTTTGTAATGGATGCTCTGAAGATATTAAA
GAAGATTACTTCTCAAAATGTTAAAATTGTAAATCAATATTCTGCTTGGAATGTGATATT
TTAATACACAAGCAAAAGCTAAATTGTCCTAAATGTTGA


>TTHERM_00152050(gene)
ATGGATATTGAAGAAGCAGATAGAAGATCAATTATTGATTTCGTAGAATAAAAACTAAAT
ATTAAAGAAGAAAATCCTTTAATACAAACAAAGAAAATCATCGATAAAGGATATACCTCT
ACAACAAAAAAGAGTCTCCTAAGATTTGTATATATTATAGTTGATACAACCTAATCTTCT
ACAAGAGTAGATTTCAAGCCTTCGAGAATAGGACTAACGTAAATCTACTTAAAGGTAATA
ATATTGCATTCAAAATTTTTAATTTATAAAAAATTAATATTATTTTTAATATTAATTAGA
ACTTCATAAAAAACTTTTTTGATTCTAATCCTTTGAGTGTATTATCTATTGGTAAAACAT
AAAATGGCTAGTGTATAACTCTTTAAGAATTTACATCTAGTATATCTCTTTTAGATAAAA
CAATCGAAAAACTTGTAGTTGATGAAAAGGAGGATTTTTCTCTTTTTGAATGTTTAAATG
TAAATTTATAAATTTCTTTTGAATGTTTGTGAATAAAATATTTTTTAAGACCAAATCTTT
ATCTAAAAAACATTTAAAATAAAGGAAACTTTTAATATTTTTGCTGAAGCACCTCCATAT
GCTTTCAGAGAAGTAGTTCTAATTTAGTCAACACCTTCAACAAAAGATAAAGGTGATATA
AATGAATAAATAAATAAAGCCAAATAATGCAAAATAACTTTTAATATTATATCACTTAAT
GCAAAAACATTCATATTTTAGGTAAATAGATTTTAAATTTATACATTGCACAAACCATGC
AAAACTCTATATTTAATAGAAATTGACAAAAGAGACATAAGGTAAATATGACACAGCTTT
ACATGAAAAAGATTATGAAAATTTACTTAACAGCTATTGTGAACCTCCATAATAAATATT
AAATAAAACTGAAAAAACTCTTATACAAGTTGGTTTCCCTAATAAAAAATATTCTAAAAT
TTCTGTATTATGTGCTTGCCATATGGAGTTAAAAACTAACTTTTACATTTGCCCTTAATG
CAAAAGTAAAAACTGTGAAGTTCCTTCAAAATGTTCAGTAACTAATTTTTTAGAATTTTT
AAAAATTTACAAGTTTTTATTAAATTTACTAATAAGGGATGCCAATTAAATTTAATTCTT
CCTTTGCATATCACAAAGAGCTATCATTTTAGTTAAAATTTAAAAGAATTCGAATTGTTA
GGACAAGAAAAATCTAATAATAGTATGGAAACCGAGTAAGATAAAACATAAAATATCCTT
TGTAATGGATGCTCTGAAGATATTAAAGAAGATTACTTCTCAAAATGTTAAAATTGTAAA
TCAATATTCTGCTTGTAAATTAATTGTTTTATTCACACAAGCAACTTTTTAACAATTTTT
TAACTAAATTTTATAGGGAATGTGATATTTTAATACACAAGCAAAAGCTAAATTGTCCTA
AATGTTGA


>TTHERM_00152050(protein)
MDIEEADRRSIIDFVEQKLNIKEENPLIQTKKIIDKGYTSTTKKSLLRFVYIIVDTTQSS
TRVDFKPSRIGLTQIYLKNFIKNFFDSNPLSVLSIGKTQNGQCITLQEFTSSISLLDKTI
EKLVVDEKEDFSLFECLNETFNIFAEAPPYAFREVVLIQSTPSTKDKGDINEQINKAKQC
KITFNIISLNAKTFIFQKLTKETQGKYDTALHEKDYENLLNSYCEPPQQILNKTEKTLIQ
VGFPNKKYSKISVLCACHMELKTNFYICPQCKSKNCEVPSKCSGCQLNLILPLHITKSYH
FSQNLKEFELLGQEKSNNSMETEQDKTQNILCNGCSEDIKEDYFSKCQNCKSIFCLECDI
LIHKQKLNCPKC