Identifiers and Description

Gene Model Identifier

TTHERM_00155430

Standard Name

NTP9 (Nucleoside transporter 9)

Aliases

PreTt28333 | 13.m00292 | 3829.m01141

Description

NTP9 equilibrative nucleoside transporter family protein; Nucleoside transporter family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01733 ) Nucleoside transporter
  • ( PF06103 ) Bacterial protein of unknown function
  • ( PF07690 ) transporter, major facilitator family
  • ( TIGR00939 ) Nucleoside Transporter
  • ( TIGR00997 ) intracellular septation protein A

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05228.1 9.997093137033517e-262
Description: nucleoside transporter (503 aa)
Oxytricha Contig18964.0.g30 2.99851380290819e-19
Description: Nucleoside transporter
DictyBase DDB_G0281513 0.000000030002053728821195
Description: DDB_G0281513 on chromosome: 3 position 4652073 to 4653629
SGD YAL022C 0.000009999254677478949
Description: FUN26 Vacuolar membrane transporter with broad nucleoside selectivity; may regulate balance of nicotinamide riboside (NmR) levels between cytosol and vacuole, contributing to salvage of NmR for use in cytosolic NAD+ synthesis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00155430(coding)
ATGATATAATAGAACGCTTCCTTAAATATGTAACCTGATCAACATAATTATAGTCCTCCT
CTTTCATCTGTACTAAATTTAAAAGAAAATGAAGAAGATAAAAGATAAAACTTAAATGAT
ATTTCAATTAAATAAGATTCTTAACTAAATTCATTTTTATCTGCATAAAACGCTGAAGAG
ACTTAAAAAAAGATAGATGATATTTCAAAATAAATAGATTAAATGTATGAAGTACTTCCA
CCTGTTACTAATTTCTTTAAATTTTGTTTCATGATGTTTGGTATTTTAGCCTTTGCTGGA
TGGAATGCAGTAATTACTGCTTTTGATTATTTTTCTGTGCGTTACCCTAAAGAAACTATT
CCAGATGTTACATTTTATTTCCCTTTTGGAGTTATGGTGGGTGATTTATTAAGTGGAGTC
ACTTTTGTAGCTTAAGCAAAGTATTTTTCAGTGAAATCAAGATTTATGTATACTGTTACT
GTAGAAGTAATTGTTATTATTAGTCTTTGTATAGTTGCTATGTGCTATAATAATATTAAT
GGTTTTTGGATATCAATGGTTTTATTATTTATTGATGGCTGGGCTGATAATGTAAAAACA
AACACTTTTGTAGTTATTGCAGGGAGTGTTCATCCTTAATTAAATAATCTTTTTTGGACA
TACACTGCATTTTCTGGCTTAATAATGAATGCATTAAGATTTATTGTATTAGGGATATTT
GGAGATGATCTTGATAGCAATGCTAACTATGGTACTTTGCTTTATTTTATAGCCTGTGCT
ATAATATTTATAATTGCAATTATTTGTTTTGCCATTTTTATCAAGTCAAATTACTACAAA
ACTTCATTGTAAATTGATGCCCTAAAATAGCAAAAGATCTAATTAGAAAAAGAATTATAT
TTTATTAAAAACCAAACCGAGTAAATTAGCAGCACTATCTAACACAAAGGAATTTCTAAA
ATGTTTTGGGCTGCTATTAATTATTTAAAAGAGTTTATTTTTATAACTAAGCACACAGGA
TTCCTTTCATTATACCTTTTCATTTCTTTCTTTGAAACATTCTTGCTTTTTCCTGGAGTT
TGCGTTTTCAGAAAACCTGAATTCAAGTTCTTAGAATTTGCATGGGCTGCATAAGTTATG
ATGACAGCTTTTAACCTTGGAGATTTTATTGGGAAGTATATAGGTTATATTAAATAACTA
CATCGTCTCTATTGGATTTATGGGCTGGTAATTCTAAGAATTTCTTTTGTACCAATATTT
ATTTTGATGGCCTTAAATGAAGGAAGTTCAATCTTATAAAATGACTACTTTATTATGTGT
ATGATATTCCTTTTTTCTATAACTAATGGGTTTATTACTACAAGCTTAACTCATTTATCT
CCAAGAAAAATAACTGATCCTTATATTAGGGATAAAGTTAACTTTTTTAGTAATTTTACT
ATGACCTTAGGTATTGATCTTGGCATAGTCTTAGCTATTTTCTTAAGTAACGCTCTGCCA
AACTACAGTTGA


>TTHERM_00155430(gene)
ATGATATAATAGAACGCTTCCTTAAATATGTAACCTGATCAACATAATTATAGTCCTCCT
CTTTCATCTGTACTAAATTTAAAAGAAAATGAAGAAGATAAAAGATAAAACTTAAATGAT
ATTTCAATTAAATAAGATTCTTAACTAAATTCATTTTTATCTGCATAAAACGCTGAAGAG
ACTTAAAAAAAGATAGATGATATTTCAAAATAAATAGATTAAATGTATGAAGTACTTCCA
CCTGTTACTAATTTCTTTAAATTTTGTTTCATGATGTTTGGTATTTTAGCCTTTGCTGGA
TGGAATGCAGTAATTACTGCTTTTGATTATTTTTCTGTGCGTTACCCTAAAGAAACTATT
CCAGATGTTACATTTTATTTCCCTTTTGGAGTTATGGTGGGTGATTTATTAAGTGGAGTC
ACTTTTGTAGCTTAAGCAAAGTATTTTTCAGTGAAATCAAGATTTATGTATACTGTTACT
GTAGAAGTAATTGTTATTATTAGTCTTTGTATAGTTGCTATGTGCTATAATAATATTAAT
GGTTTTTGGATATCAATGGTTTTATTATTTATTGATGGCTGGGCTGATAATGTAAAAACA
AACACTTTTGTAGTTATTGCAGGGAGTGTTCATCCTTAATTAAATAATCTTTTTTGGACA
TACACTGCATTTTCTGGCTTAATAATGAATGCATTAAGATTTATTGTATTAGGGATATTT
GGAGATGATCTTGATAGCAATGCTAACTATGGTACTTTGCTTTATTTTATAGCCTGTGCT
ATAATATTTATAATTGCAATTATTTGTTTTGCCATTTTTATCAAGTCAAATTACTACAAA
ACTTCATTGTAAATTGATGCCCTAAAATAGCAAAAGATCTAATTAGAAAAAGAATTATAT
TTTATTAAAAACCAAACCGAGTAAATTAGCAGCACTATCTAACACAAAGGAATTTCTAAA
ATGTTTTGGGCTGCTATTAATTATTTAAAAGAGTTTATTTTTATAACTAAGCACACAGGA
TTCCTTTCATTATACCTTTTCATTTCTTTCTTTGAAACATTCTTGCTTTTTCCTGGAGTT
TGCGTTTTCAGAAAACCTGAATTCAAGTTCTTAGAATTTGCATGGGCTGCGTAAAATTTA
ATTTCTTTTTTATGTTAGATCTAAATTGTATTAAAACAATTTTTTACAAATTAAAATATA
ATCAAAATACTGCATCTAAACAAAGCAGTAAAAGCAATAATCAAATTAATAAAAAAATAT
GATTTTGGATTGTTATATCTAATAAACTTTTTTTAAAAATGAGATAAAATAGAATTTAAA
TAACAAAAATAAAAAATAATTTACAAGAAAATTGTATTTTAATGAAATTGTTTATTTAAA
TTATAAAAAATACATATTTTAAGTTATTGAAAAAATAGATTATTTAAATAATAATAATAT
TAATTTTATTAATAGATAAGTTATGATGACAGCTTTTAACCTTGGAGATTTTATTGGGAA
GTATATAGGTTATATTAAATAACTACATCGTCTCTATTGGATTTATGGGCTGGTAATTCT
AAGAATTTCTTTTGTACCAATATTTATTTTGATGGCCTTAAATGAAGGAAGTTCAATCTT
ATAAAATGACTACTTTATTATGTGTATGATATTCCTTTTTTCTATAACTAATGGGTTTAT
TACTACAAGCTTAACTCATTTATCTCCAAGAAAAATAACTGATCCTTATATTAGGGATAA
AGTTAACTTTTTTAGTAATTTTACTATGACCTTAGGTATTGATCTTGGCATAGTCTTAGC
TATTTTCTTAAGTAACGCTCTGCCAAACTACAGTTGA


>TTHERM_00155430(protein)
MIQQNASLNMQPDQHNYSPPLSSVLNLKENEEDKRQNLNDISIKQDSQLNSFLSAQNAEE
TQKKIDDISKQIDQMYEVLPPVTNFFKFCFMMFGILAFAGWNAVITAFDYFSVRYPKETI
PDVTFYFPFGVMVGDLLSGVTFVAQAKYFSVKSRFMYTVTVEVIVIISLCIVAMCYNNIN
GFWISMVLLFIDGWADNVKTNTFVVIAGSVHPQLNNLFWTYTAFSGLIMNALRFIVLGIF
GDDLDSNANYGTLLYFIACAIIFIIAIICFAIFIKSNYYKTSLQIDALKQQKIQLEKELY
FIKNQTEQISSTIQHKGISKMFWAAINYLKEFIFITKHTGFLSLYLFISFFETFLLFPGV
CVFRKPEFKFLEFAWAAQVMMTAFNLGDFIGKYIGYIKQLHRLYWIYGLVILRISFVPIF
ILMALNEGSSILQNDYFIMCMIFLFSITNGFITTSLTHLSPRKITDPYIRDKVNFFSNFT
MTLGIDLGIVLAIFLSNALPNYS