Identifiers and Description

Gene Model Identifier

TTHERM_00158170

Standard Name

TGL8 (TriGlyceride Lipase)

Aliases

PreTt28407 | 13.m00366 | 3829.m01220

Description

TGL8 Ab-hydrolase associated lipase region protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00561 ) hydrolase, alpha/beta fold family
  • ( PF04083 ) ab-hydrolase associated lipase region
  • ( PF05704 ) Capsular polysaccharide synthesis protein
  • ( PF08108 ) Halocidin family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05274.1 9.997093137033517e-262
Description: ab-hydrolase associated lipase region family protein (422 aa)
DictyBase DDB_G0268740 1.9991939848149086e-44
Description: lip2 on chromosome: 1 position 2028102 to 2029414
Oxytricha Contig10401.0.g79 1.9991939848149086e-44
Description: Partial alpha/beta-hydrolase lipase region
WormBase WBGene00010062 6.000354955737408e-39
Description: locus:lipl-1 Lipase status:Confirmed UniProt:Q93789 protein_id:CAB01973.1
Stentor Coeruleus SteCoe_29520 1.2995814250075031e-24
Description: None
SGD YKL140W 7.001446474249442e-19
Description: TGL1 Steryl ester hydrolase, one of three gene products (Yeh1p, Yeh2p, Tgl1p) responsible for steryl ester hydrolase activity and involved in sterol homeostasis; localized to lipid particle membranes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00158170(coding)
ATGGGCGTATAATTTGAATAACCCTCTAATTTACCAACAATGATCAAGAATTTTTGCTTA
TAGTTTACTAAAATATATTGTGCTTTTTTAGTAGTCATCATCATTTCTATAGGATAAATG
GCTTTGATGGAAATGCAGATAAAAGACCCTCTATAACGTCCTCATCAAATAAAATACACT
GATTATACAGATATTTTAAACTATCCTACTTAAGAGTACAATATAACTACTGAAGATGGT
TATATCATTAATATTATAAGAATACAAGCTAAAAATACTACCATTTAAGAGCATGGAAAG
CCTCCTGTTTTGATGTATTTCGGTCTTAATTGTGCTATTGAGGTTTTCAGTATGAATAAT
GAAGAATAATCTCCTACTTTTTTTGTTGCTAATCAAGGCTATGATGTTTGGATGATCGCT
AATAGAGGCACATTATACTCAAGTGGACACGTTAACTTAACATAAAATGACCCAGAATAC
TGGTAATTTTCATGGTAGGAAATGGCAGAATATGATTTCAGGAGTGCATTCGATTTTATT
TATGAAAAAGTAGGCAGAAAAAAAATATCTACCATAGGATTTTCTTAAGGCACAACTATA
TTATTAGCTGCTTTAGCTGATTATCCAAATTATTAATAGAAAATAACACAAATGATTTTA
ATGGGCCCAACTGCTAACATAATAAATTAGAATTCACCTGCTTTCACCTTAGGTATAAAC
ATTGGAGGTGCTCCTTTGCTAAAGAAATTGGGCATAAACAAGCTTGTAGATGAATATAAA
TTGCTTTATTATGGCACAAAATATCTTTCTACTTTTGCTCACTTTGTTTTGAGTTAAATA
ACTGATTCTGACGTTACAGTTTTGAACTAAGAAAGATTCTAGTACTTTATGGCAACATAT
CCAGGAGGCACTTCAGTGTAAGTTTATGACCATTGGTAATAATTAGCCAGTGAAACAGAT
TAATTTAGAAAATATGACTATAGAAACGTCACTAAAAATATTATAAAATACGGCAGTGAG
GTCCCTCCTACTTACAATTTATAAAATATTAAAGTGCCTACACATTTGTTTGTTGGCAGA
TATGATAGGTTGGGCAGTCCTGAAGATGCACAAATACTTTACGAAAGTCTTAAACTCTCC
TCTGTAAATGCAACTATGTAATTATATGATGGAGGACATCTCTACTTCGCTATAGGACGC
GAAACTCCTTTTCTTTAAAAGCTTTAATAAATGTTGATTGACTAGCATAAAGCTGATGAT
TGA


>TTHERM_00158170(gene)
ATGGGCGTATAATTTGAATAACCCTCTAATTTACCAACAATGATCAAGAATTTTTGCTTA
TAGTTTACTAAAATATATTGTGCTTTTTTAGTAGTCATCATCATTTCTATAGGATAAATG
GCTTTGATGGAAATGCAGATAAAAGACCCTCTATAACGTCCTCATCAAATAAAATACACT
GATTATACAGATATTTTAAACTATCCTACTTAAGAGTACAATATAACTACTGAAGATGGT
TATATCATTAATATTATAAGAATACAAGCTAAAAATACTACCATTTAAGAGCATGGAAAG
CCTCCTGTTTTGATGTATTTCGGTCTTAATTGTGCTATTGAGGTTTTCAGTATGAATAAT
GAAGAATAATCTCCTACTTTTTTTGTTGCTAATCAAGGCTATGATGTTTGGATGATCGCT
AATAGAGGCACATTATACTCAAGTGGACACGTTAACTTAACATAAAATGACCCAGAATAC
TGGTAATTTTCATGGTAGGAAATGGCAGAATATGATTTCAGGAGTGCATTCGATTTTATT
TATGAAAAAGTAGGCAGAAAAAAAATATCTACCATAGGATTTTCTTAAGGCACAACTATA
TTATTAGCTGCTTTAGCTGATTATCCAAATTATTAATAGAAAATAACACAAATGATTTTA
ATGGGCCCAACTGCTAACATAATAAATTAGAATTCACCTGCTTTCACCTTAGGTATAAAC
ATTGGAGGTGCTCCTTTGCTAAAGAAATTGGGCATAAACAAGCTTGTAGATGAATATAAA
TTGCTTTATTATGGCACAAAATATCTTTCTACTTTTGCTCACTTTGTTTTGAGTTAAATA
ACTGATTCTGACGTTACAGTTTTGAACTAAGAAAGATTCTAGTACTTTATGGCAACATAT
CCAGGAGGCACTTCAGTGTAAGTTTATGACCATTGGTAATAATTAGCCAGTGAAACAGAT
TAATTTAGAAAATATGACTATAGAAACGTCACTAAAAATATTATAAAATACGGCAGTGAG
GTCCCTCCTACTTACAATTTATAAAATATTAAAGTGCCTACACATTTGTTTGTTGGCAGA
TATGATAGGTTGGGCAGTCCTGAAGATGCACAAATACTTTACGAAAGTCTTAAACTCTCC
TCTGTAAATGCAACTATGTAATTATATGATGGAGGACATCTCTACTTCGCTATAGGACGC
GAAACTCCTTTTCTTTAAAAGCTTTAATAAATGTTGATTGACTAGCATAAAGCTGATGAT
TGA


>TTHERM_00158170(protein)
MGVQFEQPSNLPTMIKNFCLQFTKIYCAFLVVIIISIGQMALMEMQIKDPLQRPHQIKYT
DYTDILNYPTQEYNITTEDGYIINIIRIQAKNTTIQEHGKPPVLMYFGLNCAIEVFSMNN
EEQSPTFFVANQGYDVWMIANRGTLYSSGHVNLTQNDPEYWQFSWQEMAEYDFRSAFDFI
YEKVGRKKISTIGFSQGTTILLAALADYPNYQQKITQMILMGPTANIINQNSPAFTLGIN
IGGAPLLKKLGINKLVDEYKLLYYGTKYLSTFAHFVLSQITDSDVTVLNQERFQYFMATY
PGGTSVQVYDHWQQLASETDQFRKYDYRNVTKNIIKYGSEVPPTYNLQNIKVPTHLFVGR
YDRLGSPEDAQILYESLKLSSVNATMQLYDGGHLYFAIGRETPFLQKLQQMLIDQHKADD