Identifiers and Description

Gene Model Identifier

TTHERM_00158520

Standard Name

HSP82 (Heat Shock Protein 82 )

Aliases

PreTt28442 | 13.m00537 | 3829.m01257

Description

HSP82 predicted protein; Hsp90 family member; 82 kDa heat shock-inducible protein; found in heat shock induced cytosolic hetero-oligomeric complexes with tubulin and hsp73; localizes to mature basal bodies and cortical cytoskeleton; involved in cortical patterning

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00183 ) Hsp90 protein
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase
  • ( PF06908 ) Protein of unknown function (DUF1273)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_14295 0
Description: None
WormBase WBGene00000915 9.997093137033517e-262
Description: locus:daf-21 Heat shock protein 90 status:Confirmed UniProt:Q18688 protein_id:CAA99793.1
Tetrahymena borealis EI9_05309.1 9.997093137033517e-262
Description: hsp90-like protein (705 aa)
DictyBase DDB_G0267400 9.997093137033517e-262
Description: hspD on chromosome: 1 position 1280990 to 1283391
Oxytricha Contig17274.0.g46 9.997093137033517e-262
Description: Hsp90 protein
SGD YPL240C 9.997093137033517e-262
Description: HSP82 Hsp90 chaperone required for pheromone signaling and negative regulation of Hsf1p; docks with Tom70p for mitochondrial preprotein delivery; promotes telomerase DNA binding and nucleotide addition; interacts with Cns1p, Cpr6p, Cpr7p, Sti1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:15154550: Ketola T, Laakso J, Kaitala V, Airaksinen S (2004) Evolution of Hsp90 expression in Tetrahymena thermophila (Protozoa, Ciliata) populations exposed to thermally variable environments. Evolution; international journal of organic evolution 58(4):741-8
  3. Ref:12095102: Frankel J, Williams NE, Nelsen EM, Keeling PJ (2002) An evaluation of Hsp90 as a mediator of cortical patterning in Tetrahymena. The Journal of eukaryotic microbiology 48(2):147-60
  4. Ref:9247200: Williams NE, Nelsen EM (1997) HSP70 and HSP90 homologs are associated with tubulin in hetero-oligomeric complexes, cilia and the cortex of Tetrahymena. Journal of cell science 110 ( Pt 14)( ):1665-72

Sequences

>TTHERM_00158520(coding)
ATGTCTCAACAAGCTGAACACTTTGCTTTCGAAGCCGATATCCAACAATTGATGGGTTTG
ATCATCAACACTTTCTACTCCAACAAGGAAATTTTCTTGAGAGAATTGATTTCCAATGCC
TCCGATGCTTTGGATAAGATTAGATACATTTCCATCACCGACAGCGAAAAAGCCAAGTTA
GAAGTTGAACCTAACTTCAGAATTAGAATCATTCCCGATAAGGCCAACAATACCCTTACC
CTCTGGGATACCGGTATTGGTATGACCAAGAAGGAATTGATCAACAACTTGGGTACTATC
GCTAAGTCTGGTACCAAGGCCTTCATGGAAGCCCTCTCCAGTGGTGCTGATATTTCTATG
ATTGGTCAATTCGGTGTCGGTTTTTACTCTGCTTACTTGGTTGCCGAAAAGGTCGAAGTT
ATCTCCAAGTCCAACGATGATGAATCCCAATGGAGATGGGAATCCTCTGCTGGTGGTACT
TTCACCGTCGTCAACGATGATGAAAACCCTGAAAAGCTCACCAGAGGTACCAAGATCATC
CTCCACATGAAGAACGATAACTTAGAATTCTTAGAAGAAAGAAGAATCAAGGACTTGATC
AAGAAGCACTCTGAATTCATTGCTTTCCCCATCGAATTATAAGTTGAAAAGACCGAAGAA
AAGGAAGAAACCGACGAAGAAGATGAAGAAAAGGAAAAGGAAGATAAGGAAAAGACCGAT
GAACCCGAAATTAAGGAAGAAACCGAAAAGAAGGACAAGAAGAAAAAGAAAGTTAAAGTT
GTCCACACTGAATTCGAAGAATAAAACAAGAACAAGCCTCTTTGGATGAGAAAGCCCGAA
GAAATCACCAAGGAAGAATACGTTAACTTCTACAAGTCCCTCACCAACGATTGGGAAGAA
CACTAAGCTGTCAAGCAATTCTCCGTTGAAGGTCAACTCGAATTCAGAGCTATCCTCTTC
ATCCCCAAGAGAGCTCCCTTCGACTTATTCGAAACCAAGAAGAAGAAAAACAACATCAAG
CTCTACGTCAGAAGAGTCTTCATTATGGATGACTGCGAAGAACTCATCCCCGAATATCTT
AACTTCATTAAGGGTGTTGTTGATTCTGAAGATCTCCCTCTTAACATCTCCAGAGAATTC
CTCCAACACAACAAGATCCTCAAGGTCATCAAGAAGAACATCGTCAAGAAGTGCCTCGAC
CTTATCCAAGAAGTTGCTGATAACGAAGAAGACTTCAAGAAGTTCTACGAACAATTCGGT
AAGAACCTCAAGCTCGGTATCCACGAAGACTCTGCCAACAGAGAAAAGCTCTCTTCCTTC
CTCAGATATCACTCCTCCAAGTCTGGTGAAGAATTAACCACCCTCAAGGACTACGTCTCC
AGAATGAAAGAAGGTCAAAAGGACATTTTCTTCATTACTGGTGAATCCAGAGCTGCTGTT
GCTGCTTCTCCCTTCGTTGAAAGCCTTAGAAAGAGAGGTTATGAAGTCCTTTACATGGTT
GACCCCATCGATGAATACGTCATCCAACAATTAAAGGAATACGACGGTAAGAAACTCAAG
AACTGCTCCAAGGAAGGTCTTGAACTCGAATAAACTGAAGATGAAAAGAAGAAGTTCGAA
GAAAAGAAGGCTGCCTACGAACCTCTTTGCAAGCAAATCAAGGAAGTCCTCGGTGACAAG
GTCGAAAAGGTCGTCGTTGGTCAAAGACTCGACGAATCTCCTTGCGTCCTCGTTACTGGT
GAATACGGCTGGTCCGCCAATATGGAAAGAATCATGAAGGCTCAAGCTCTCAGAGATGCT
TCCATGTCCACATATATGATCTCCAAGAAGACCATGGAAATCAATCCCGATAACGCCATC
GTCTAAGAACTCAAGACCAGATCCGACAAGGACAAGGCTGACAAGACCGTCAAGGATCTC
ATCTGGTTACTCTTCGAAACCTCCCTCCTCACTTCTGGTTTCTCCCTCGATGACCCCTCT
TCTTTCGCTAACAGAATCCACAGAATGATTAAGCTTGGTCTCCAATTGGACGACTCTCAC
ATTGATGAAGAAGTTCCCGGACTTAGCCAAGAAGCTGAAAAGACTGAAAACACCAACAAC
GCTATGGAAGATGTTGATTGA


>TTHERM_00158520(gene)
ATGTCTCAACAAGCTGAACACTTTGCTTTCGAAGCCGATATCCAACAATTGATGGGTTTG
ATCATCAACACTTTCTACTCCAACAAGGAAATTTTCTTGAGAGAATTGATTTCCAATGCC
TCCGATGCTTTGGATAAGATTAGATACATTTCCATCACCGACAGCGAAAAAGCCAAGTTA
GAAGTTGAACCTAACTTCAGAATTAGAATCATTCCCGATAAGGCCAACAATACCCTTACC
CTCTGGGATACCGGTATTGGTATGACCAAGAAGGAATTGATCAACAACTTGGGTACTATC
GCTAAGTCTGGTACCAAGGCCTTCATGGAAGCCCTCTCCAGTGGTGCTGATATTTCTATG
ATTGGTCAATTCGGTGTCGGTTTTTACTCTGCTTACTTGGTTGCCGAAAAGGTCGAAGTT
ATCTCCAAGTCCAACGATGATGAATCCCAATGGAGATGGGAATCCTCTGCTGGTGGTACT
TTCACCGTCGTCAACGATGATGAAAACCCTGAAAAGCTCACCAGAGGTACCAAGATCATC
CTCCACATGAAGAACGATAACTTAGAATTCTTAGAAGAAAGAAGAATCAAGGACTTGATC
AAGAAGCACTCTGAATTCATTGCTTTCCCCATCGAATTATAAGTTGAAAAGACCGAAGAA
AAGGAAGAAACCGACGAAGAAGATGAAGAAAAGGAAAAGGAAGATAAGGAAAAGACCGAT
GAACCCGAAATTAAGGAAGAAACCGAAAAGAAGGACAAGAAGAAAAAGAAAGTTAAAGTT
GTCCACACTGAATTCGAAGAATAAAACAAGAACAAGCCTCTTTGGATGAGAAAGCCCGAA
GAAATCACCAAGGAAGAATACGTTAACTTCTACAAGTCCCTCACCAACGATTGGGAAGAA
CACTAAGCTGTCAAGCAATTCTCCGTTGAAGGTCAACTCGAATTCAGAGCTATCCTCTTC
ATCCCCAAGAGAGCTCCCTTCGACTTATTCGAAACCAAGAAGAAGAAAAACAACATCAAG
CTCTACGTCAGAAGAGTCTTCATTATGGATGACTGCGAAGAACTCATCCCCGAATATCTT
AACTTCATTAAGGGTGTTGTTGATTCTGAAGATCTCCCTCTTAACATCTCCAGAGAATTC
CTCCAACACAACAAGATCCTCAAGGTCATCAAGAAGAACATCGTCAAGAAGTGCCTCGAC
CTTATCCAAGAAGTTGCTGATAACGAAGAAGACTTCAAGAAGTTCTACGAACAATTCGGT
AAGAACCTCAAGCTCGGTATCCACGAAGACTCTGCCAACAGAGAAAAGCTCTCTTCCTTC
CTCAGATATCACTCCTCCAAGTCTGGTGAAGAATTAACCACCCTCAAGGACTACGTCTCC
AGAATGAAAGAAGGTCAAAAGGACATTTTCTTCATTACTGGTGAATCCAGAGCTGCTGTT
GCTGCTTCTCCCTTCGTTGAAAGCCTTAGAAAGAGAGGTTATGAAGTCCTTTACATGGTT
GACCCCATCGATGAATACGTCATCCAACAATTAAAGGAATACGACGGTAAGAAACTCAAG
AACTGCTCCAAGGAAGGTCTTGAACTCGAATAAACTGAAGATGAAAAGAAGAAGTTCGAA
GAAAAGAAGGCTGCCTACGAACCTCTTTGCAAGCAAATCAAGGAAGTCCTCGGTGACAAG
GTCGAAAAGGTCGTCGTTGGTCAAAGACTCGACGAATCTCCTTGCGTCCTCGTTACTGGT
GAATACGGCTGGTCCGCCAATATGGAAAGAATCATGAAGGCTCAAGCTCTCAGAGATGCT
TCCATGTCCACATATATGATCTCCAAGAAGACCATGGAAATCAATCCCGATAACGCCATC
GTCTAAGAACTCAAGACCAGATCCGACAAGGACAAGGCTGACAAGACCGTCAAGGATCTC
ATCTGGTTACTCTTCGAAACCTCCCTCCTCACTTCTGGTTTCTCCCTCGATGACCCCTCT
TCTTTCGCTAACAGAATCCACAGAATGATTAAGCTTGGTCTCCAATTGGACGACTCTCAC
ATTGATGAAGAAGTTCCCGGACTTAGCGTAAGCTTTTTGAATTTTTTAAATATTTCTCAA
ATTTCTCAATTAATTAATTTGTAATATTCTAATTCTAAATCCTATTTTTTATTAAATAAT
AGCAAGAAGCTGAAAAGACTGAAAACACCAACAACGCTATGGAAGATGTTGATTGA


>TTHERM_00158520(protein)
MSQQAEHFAFEADIQQLMGLIINTFYSNKEIFLRELISNASDALDKIRYISITDSEKAKL
EVEPNFRIRIIPDKANNTLTLWDTGIGMTKKELINNLGTIAKSGTKAFMEALSSGADISM
IGQFGVGFYSAYLVAEKVEVISKSNDDESQWRWESSAGGTFTVVNDDENPEKLTRGTKII
LHMKNDNLEFLEERRIKDLIKKHSEFIAFPIELQVEKTEEKEETDEEDEEKEKEDKEKTD
EPEIKEETEKKDKKKKKVKVVHTEFEEQNKNKPLWMRKPEEITKEEYVNFYKSLTNDWEE
HQAVKQFSVEGQLEFRAILFIPKRAPFDLFETKKKKNNIKLYVRRVFIMDDCEELIPEYL
NFIKGVVDSEDLPLNISREFLQHNKILKVIKKNIVKKCLDLIQEVADNEEDFKKFYEQFG
KNLKLGIHEDSANREKLSSFLRYHSSKSGEELTTLKDYVSRMKEGQKDIFFITGESRAAV
AASPFVESLRKRGYEVLYMVDPIDEYVIQQLKEYDGKKLKNCSKEGLELEQTEDEKKKFE
EKKAAYEPLCKQIKEVLGDKVEKVVVGQRLDESPCVLVTGEYGWSANMERIMKAQALRDA
SMSTYMISKKTMEINPDNAIVQELKTRSDKDKADKTVKDLIWLLFETSLLTSGFSLDDPS
SFANRIHRMIKLGLQLDDSHIDEEVPGLSQEAEKTENTNNAMEDVD