Identifiers and Description

Gene Model Identifier

TTHERM_00161130

Standard Name

CTH90 (CaTHepsin 90)

Aliases

PreTt28505 | 13.m00464 | 3829.m01326

Description

CTH90 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_05369.1 9.997093137033517e-262
Description: papain family cysteine protease containing protein (326 aa)
Oxytricha Contig19092.0.g43 6.002330506118426e-84
Description: Papain family cysteine protease
DictyBase DDB_G0272815 9.996162112727537e-67
Description: cprE on chromosome: 2 position 2212329 to 2213613
WormBase WBGene00000776 1.0003503620230312e-57
Description: locus:cpl-1 status:Confirmed UniProt:O45734 protein_id:CAB07275.1
Stentor Coeruleus SteCoe_2628 3.3057006267607343e-37
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161130(coding)
ATGAACAAAATTCTTTTAGGAGTCTCTGTCTTGCTTCTTTTGGGTTTGACCACTGTCTTT
TTGGTTGAAAAACAAAACAACGGTTTAAGAGCTGAAGTTGATGAATTCCAAGCTTGGATG
CACAAGTACGGATTCAAGTTCGCTGACGAAGTTCAATTATAATACAGAAGATCTATCTTC
TACTAAAACAAGGATCTTGTTGAATAACTCAATTCCGAAAACAACGGTACCTTCCACACT
TTGAATGCTTTCGCCATTTACACTAAGGACGAATTCAACCAATTATTCAAGGGTTACTAA
AAGAGATAAAAGAGTCACTTAATCTACTCCTTGAAGGGTGATGTTGCTCCCTCTATTGAT
TGGAGATAAAAGAATGCTGTTACCCCTGTCAAGAACTAAGGTCAATGCGGTTCATGCTGG
GCTTTCTCCACTGTTGGTGGTCTTGAAGGTGCTTACGCCATCGCTACTGGAAACTTGACT
TCCTTCTCTGAATAACAAATTGTCGACTGCTCTAAGGCTAATGCTGGTTGCAATGGTGGT
GATTTACCTCCTGCTTACAAATACGTCGTCTAAAACGGTATTGAAACTGAAGCTGACTAT
CCTTACAAGGGTGTTAACTAAAAGTGTGCATATGATGCTTCTAAGGTTGTCTTCAAACCC
AAGAGCTTCGTTTAGGTTACTCCTAACAGCCCCGACTAATTGGCTATTGCTCTTAACAAG
GAACCCGTTCCAATTTGTATCGAAGCTGACCAAAAGGCTTTCTAATTCTACACCTCTGGT
ATCATTTCCAGTGGTTGCGGTACTAATTTGGATCACTGCGTCCTCGCTGTTGGTTATGAT
GCTGACTCTTGGATTGTCAAGAACTCTTGGGGTGCCAGTTGGGGTGAAAACGGTTACGTT
AGAATTGCTAGAACCACCGCTAAGGGTCCTGGTGTCTGCGGTATCTACGAAGAACCCGTT
TATCCTATCTACTGA


>TTHERM_00161130(gene)
ATGAACAAAATTCTTTTAGGAGTCTCTGTCTTGCTTCTTTTGGGTTTGACCACTGTCTTT
TTGGTTGAAAAACAAAACAACGGTTTAAGAGCTGTAATTATTTCGATTATTATTGTTAAT
TCTAGTTTAGTATTTTAATTGTTTTCGATGATTTTATTTATGTTGGAGACATAAAAAATA
AGGACTGAGTAGACTTTAAGAAATTTGTCTATATACTTATTATTAAACACTACATTAAGT
TTTAAACATTTAATTAACTTCTAACTTTATAAATAATTAGGAAGTTGATGAATTCCAAGC
TTGGATGCACAAGTACGGATTCAAGTTCGCTGACGAAGTTCAATTATAATACAGAAGATC
TATCTTCTACTAAAACAAGGATCTTGTTGAATAACTCAATTCCGAAAACAACGGTACCTT
CCACACTTTGAATGCTTTCGCCATTTACACTAAGGACGAATTCAACCAATTATTCAAGGG
TTACTAAAAGAGATAAAAGAGTCACTTAATCTACTCCTTGAAGGGTGATGTTGCTCCCTC
TATTGATTGGAGATAAAAGGTAAAAACCTTAGAAATTATTTATTTTATTTTCCTATATCA
TTTTATTTTCTCTTCTTCACTGCTAATTATTTTTAAAATTAAAAGAATGCTGTTACCCCT
GTCAAGAACTAAGGTCAATGCGGTTCATGCTGGGCTTTCTCCACTGTTGGTGGTCTTGAA
GGTGCTTACGCCATCGCTACTGGTAAGAATTAACATTTATTAACTTTAAATAACATATTG
TCTGACATAGTTATAATTTATATTTTGATTGATTTTATCTGGTATGAAGTACACATATTC
AATAAAAGAATCTTTTTTTTATCAAGTTTAATACAATTATATTTAATTTCTAAACAAAAA
TTAAATAAATTAGGAAACTTGACTTCCTTCTCTGAATAACAAATTGTCGACTGCTCTAAG
GCTAATGCTGGTTGCAATGGTGGTGATTTACCTCCTGCTTACAAATACGTCGTCTAAAAC
GGTATTGAAACTGAAGCTGACTATCCTTACAAGGGTGTTAACTAAAAGTGTGCATATGAT
GCTTCTAAGGTTGTCTTCAAACCCAAGAGCTTCGTTTAGGTTACTCCTAACAGCCCCGAC
TAATTGGCTATTGCTCTTAACAAGGAACCCGTTCCAATTTGTATCGAAGCTGACCAAAAG
GCTTTCTAATTCTACACCTCTGGTATCATTTCCAGTGGTTGCGGTACTAATTTGGATCAC
TGCGTCCTCGCTGTTGGTTATGATGCTGACTCTTGGATTGTCAAGAACTCTTGGGGTGCC
AGTTGGGGTGAAAACGGTTACGTTAGAATTGCTAGAACCACCGCTAAGGGTCCTGGTGTC
TGCGGTATCTACGAAGAACCCGTTTATCCTATCTACTGA


>TTHERM_00161130(protein)
MNKILLGVSVLLLLGLTTVFLVEKQNNGLRAEVDEFQAWMHKYGFKFADEVQLQYRRSIF
YQNKDLVEQLNSENNGTFHTLNAFAIYTKDEFNQLFKGYQKRQKSHLIYSLKGDVAPSID
WRQKNAVTPVKNQGQCGSCWAFSTVGGLEGAYAIATGNLTSFSEQQIVDCSKANAGCNGG
DLPPAYKYVVQNGIETEADYPYKGVNQKCAYDASKVVFKPKSFVQVTPNSPDQLAIALNK
EPVPICIEADQKAFQFYTSGIISSGCGTNLDHCVLAVGYDADSWIVKNSWGASWGENGYV
RIARTTAKGPGVCGIYEEPVYPIY