Identifiers and Description

Gene Model Identifier

TTHERM_00166100

Standard Name

GST37 (Glutathione S-transferase mu 37, TtGSTm37, GSTm37)

Aliases

PreTt29717 | 14.m00284

Description

GST37 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_17214.1 9.003233894748109e-95
Description: glutathione S-transferase domain-containing protein (220 aa)
Oxytricha Contig16299.0.g15 1.9993007828132465e-27
Description: Glutathione S-transferase, N-terminal domain
Stentor Coeruleus SteCoe_29804 6.305116760146989e-16
Description: None
WormBase WBGene00001771 0.0000000010002658722841845
Description: locus:gst-23 status:Partially_confirmed UniProt:P91505 protein_id:CCD70568.1
DictyBase DDB_G0280317 0.00000019998969434520019
Description: DDB_G0280317 on chromosome: 3 position 3248423 to 3249124

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00166100(coding)
ATGATTACTTTCGGCTATTGGAACATTAGAGGCTTTGGCTAACCTATCCGCTTCTTGCTT
GCTTATTTAGGAGTGAAATACACCAATAAAACTTATGCCTCTCTTGAAGAATGGTTTGGA
AATGACAAAGACAATCTTGGTTTAGAATTCCCTAATCTTCCATATTTAATTGATGGAGAT
GTTAAGCTCATTGAGTCTTTCGCTATTCCTGTCTACTTAATTAAGAAGTACAAATAATTC
TAACTTTTAGGATTATAAGCTGATGGATCTAGCACCAATAAAGAAGTAAAAGTCACTCAG
TTAATGGGAGTTATCAGAGATATAGCAAAAGAAATCAATTTAACTTGCTTCAGACCTGAT
TTCTATGAAGTAAAAGAGAAGGTTTATACAGAAAAAGTTGAGTATATGTTTAAAAAACTT
ACAAATTTTTTAGGAAACAAGTTATTTTTGTTGGAGAGATTGACTTATGCAGATTTTCAT
TTCTATGAGTTGGTTAACCGTGTATAATACATATACCCTTAAGCAATGACTGCAGCCCTA
ACTGCTTATTTAAAAAGATTTGAAAACTTGCCTGGCATCAAAGAATATATAGCAAATCCA
AATATTAACCTTAAGGCTCACTTACCTGGTTTTATGGCAACTTGGACTGGCCCTTAATGA


>TTHERM_00166100(gene)
ATGATTACTTTCGGCTATTGGAACATTAGAGGCTTTGGCTAACCTATCCGCTTCTTGCTT
GCTTATTTAGGAGTGAAATACACCAATAAAACTTATGCCTCTCTTGAAGAATGGTTTGGA
AATGACAAAGACAATCTTGGTTTAGAATTCCCTAATCTTCCATATTTAATTGATGGAGAT
GTTAAGCTCATTGAGTCTTTCGCTATTCCTGTCTACTTAATTAAGAAGTACAAATAATTC
TAACTTTTAGGATTATAAGCTGATGGATCTAGCACCAATAAAGAAGTAAAAGTCACTCAG
TTAATGGGAGTTATCAGAGATATAGCAAAAGAAATCAATTTAACTTGCTTCAGACCTGAT
TTCTATGAAGTAAAAGAGAAGGTTTATACAGAAAAAGTTGAGTATATGTTTAAAAAACTT
ACAAATTTTTTAGGAAACAAGTTATTTTTGTTGGAGAGATTGACTTATGCAGATTTTCAT
TTCTATGAGTTGGTTAACCGTGTATAATACATATACCCTTAAGCAATGACTGCAGCCCTA
ACTGCTTATTTAAAAAGATTTGAAAACTTGCCTGGCATCAAAGAATATATAGCAAATCCA
AATATTAACCTTAAGGCTCACTTACCTGGTTTTATGGCAACTTGGACTGGCCCTTAATGA


>TTHERM_00166100(protein)
MITFGYWNIRGFGQPIRFLLAYLGVKYTNKTYASLEEWFGNDKDNLGLEFPNLPYLIDGD
VKLIESFAIPVYLIKKYKQFQLLGLQADGSSTNKEVKVTQLMGVIRDIAKEINLTCFRPD
FYEVKEKVYTEKVEYMFKKLTNFLGNKLFLLERLTYADFHFYELVNRVQYIYPQAMTAAL
TAYLKRFENLPGIKEYIANPNINLKAHLPGFMATWTGPQ