Identifiers and Description

Gene Model Identifier

TTHERM_00170260

Standard Name

SAP3 (Swc4-associated protein 3)

Aliases

PreTt29737 | 14.m00304

Description

Leishmanolysin-like peptidase; Member of the SWR complex.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04702 ) Vicilin N terminal region

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09987.1 9.997093137033517e-262
Description: hypothetical protein (535 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00170260(coding)
ATGTCTACTTTGGCTTCTGTAAAAAAGGATTAGGCGGTTATCAAGGATATCATGAAGTTT
AAGTTCAAAGAGCCCAAATTGAGAGAAACTACTTTGGATAAATCTGTTAGATGCATGACA
TTAGGTATTAAAAAACAGAATTTAATAAAGGAGTTTCTTATTGATGAAATTCAGTCAATA
GATTTATGCGTTGATAGGATTTACGAAATCAAGAGATAACTCAAGTTAGAAAGATAAGAG
TTTTTCAGAAGGCCTTTGACTTAAGCAAGGATAAAAGAAAAAAGAAAGAATGATGAGCAC
TACGATGATTTTATAAATGACTACGAAGAATAGGAAAGCAAATTGAAGGATTATGAGCTC
GTTTATTATAATATTAAGAGTTAAAACAACAAAGCTACTACTTATGCTACAATAACTGCA
TCCACTGATGCTAATCCTGTTTCTGTTGCCGCGTCTTCTAAGATTTTGGGTATAGACAAA
GAAAAGACAGCAGGAGAGAAGAAAAAAGAAAAAAAGAATTTACAAATGTATGGAAAATTA
ATTTAAAAAGACCCTGTTTTCAGAATGTACAAAACAAAAATGGCAGACGATGGCATGTTT
GTTGATGAAGAAATAGAAGCACCTTCTTTCAAGTACAAGTATTTGACAAAGGATTAGCTT
TTGCAATAGAAAATTGATAATTTACCCAAAAAGCATAACATTCCTGAAAAATACTGCAGA
TGCTGCAATTAACTAGTTAGGAGACATTATTGTCCTCATGACTACTGTGAAAAGCCATGC
TTGAGATAGGAAAAAGAAAAACGTTTAAGATAGCAGTATTTGGATAAAAATGGTGGAGTG
AGAAAACAGAAAAAACCACTTTATAGAGCAAGTATTTTGGCAAACGATATTTCTCAAGCT
AAATCTGCTTTAGATGAAACAATGACAATAGAATAATAATAGGAAGCAGAAAGAATAAAG
CAAATGAAAATTTAAGCACATTTGCAATAGTAAAAAGAGCAGGAATTAAAAATATAACAA
TTTAAGCTCTAGCATGCTGAGTAATTACAGCCTAAGAAAAAAGGAAGAAAGCCAAAAATT
AAAGTACCTGAAGGAACACCATCAAATACAAATAACAACAATTAAGGTACGAGCTAAATA
AATAGCACATATTAGCAAGCAAATCCTTCAGCAAATAATAGTGTTATGAAAGGAGATTAC
GATTCCATTTCAAAAGGTGATATGTCAATTGAGTATGCAGACAATAAGTATTAAAATATT
ATAAATAACAATTCTATGATGATGGACATTGAAAAGCAAAATAATAAAGATATACATATG
GATCCCTATATAAATAGAAAGGGATCTTTTAATATACCATCAGGTGGAAACAATCCATAT
GAAACTAAAGATAAAATAGACTATAATGATTTCACTCACAAAAACGACTCCTATCATGAT
GAGCAGTAAATCTTATAACAACTGGTTGCCCAAGAAAATGTACAAAACCTCTTAGGCAGT
AAAATTATTTATAGAGCAGAAGATTCCTCTTACGAATCAAGTAGCAGTGGAATCTCATCA
GGATCATCTGATGATGAAGATAAAATTAAGATCGATGACGATTGA


>TTHERM_00170260(gene)
ATGTCTACTTTGGCTTCTGTAAAAAAGGATTAGGCGGTTATCAAGGATATCATGAAGTTT
AAGTTCAAAGAGCCCAAATTGAGAGAAACTACTTTGGATAAATCTGTTAGATGCATGACA
TTAGGTATTAAAAAACAGAATTTAATAAAGGAGTTTCTTATTGATGAAATTCAGTCAATA
GATTTATGCGTTGATAGGATTTACGAAATCAAGAGATAACTCAAGTTAGAAAGATAAGAG
TTTTTCAGAAGGCCTTTGACTTAAGCAAGGATAAAAGAAAAAAGAAAGAATGATGAGCAC
TACGATGATTTTATAAATGACTACGAAGAATAGGAAAGCAAATTGAAGGATTATGAGCTC
GTTTATTATAATATTAAGAGTTAAAACAACAAAGCTACTACTTATGCTACAATAACTGCA
TCCACTGATGCTAATCCTGTTTCTGTTGCCGCGTCTTCTAAGATTTTGGGTATAGACAAA
GAAAAGACAGCAGGAGAGAAGAAAAAAGAAAAAAAGAATTTACAAATGTATGGAAAATTA
ATTTAAAAAGACCCTGTTTTCAGAATGTACAAAACAAAAATGGCAGACGATGGCATGTTT
GTTGATGAAGAAATAGAAGCACCTTCTTTCAAGTACAAGTATTTGACAAAGGATTAGCTT
TTGCAATAGAAAATTGATAATTTACCCAAAAAGCATAACATTCCTGAAAAATACTGCAGA
TGCTGCAATTAACTAGTTAGGAGACATTATTGTCCTCATGACTACTGTGAAAAGCCATGC
TTGAGATAGGAAAAAGAAAAACGTTTAAGATAGCAGTATTTGGATAAAAATGGTGGAGTG
AGAAAACAGAAAAAACCACTTTATAGAGCAAGTATTTTGGCAAACGATATTTCTCAAGCT
AAATCTGCTTTAGATGAAACAATGACAATAGAATAATAATAGGAAGCAGAAAGAATAAAG
CAAATGAAAATTTAAGCACATTTGCAATAGTAAAAAGAGCAGGAATTAAAAATATAACAA
TTTAAGCTCTAGCATGCTGAGTAATTACAGCCTAAGAAAAAAGGAAGAAAGCCAAAAATT
AAAGTACCTGAAGGAACACCATCAAATACAAATAACAACAATTAAGGTACGAGCTAAATA
AATAGCACATATTAGCAAGCAAATCCTTCAGCAAATAATAGTGTTATGAAAGGAGATTAC
GATTCCATTTCAAAAGGTGATATGTCAATTGAGTATGCAGACAATAAGTATTAAAATATT
ATAAATAACAATTCTATGATGATGGACATTGAAAAGCAAAATAATAAAGATATACATATG
GATCCCTATATAAATAGAAAGGGATCTTTTAATATACCATCAGGTGGAAACAATCCATAT
GAAACTAAAGATAAAATAGACTATAATGATTTCACTCACAAAAACGACTCCTATCATGAT
GAGCAGTAAATCTTATAACAACTGGTTGCCCAAGAAAATGTACAAAACCTCTTAGGCAGT
AAAATTATTTATAGAGCAGAAGATTCCTCTTACGAATCAAGTAGCAGTGGAATCTCATCA
GGATCATCTGATGATGAAGATAAAATTAAGATCGATGACGATTGA


>TTHERM_00170260(protein)
MSTLASVKKDQAVIKDIMKFKFKEPKLRETTLDKSVRCMTLGIKKQNLIKEFLIDEIQSI
DLCVDRIYEIKRQLKLERQEFFRRPLTQARIKEKRKNDEHYDDFINDYEEQESKLKDYEL
VYYNIKSQNNKATTYATITASTDANPVSVAASSKILGIDKEKTAGEKKKEKKNLQMYGKL
IQKDPVFRMYKTKMADDGMFVDEEIEAPSFKYKYLTKDQLLQQKIDNLPKKHNIPEKYCR
CCNQLVRRHYCPHDYCEKPCLRQEKEKRLRQQYLDKNGGVRKQKKPLYRASILANDISQA
KSALDETMTIEQQQEAERIKQMKIQAHLQQQKEQELKIQQFKLQHAEQLQPKKKGRKPKI
KVPEGTPSNTNNNNQGTSQINSTYQQANPSANNSVMKGDYDSISKGDMSIEYADNKYQNI
INNNSMMMDIEKQNNKDIHMDPYINRKGSFNIPSGGNNPYETKDKIDYNDFTHKNDSYHD
EQQILQQLVAQENVQNLLGSKIIYRAEDSSYESSSSGISSGSSDDEDKIKIDDD