Identifiers and Description

Gene Model Identifier

TTHERM_00170320

Standard Name

PFK1 (PhosphoFructoKinase)

Aliases

PreTt29743 | 14.m00310

Description

PFK1 6-phosphofructokinase; Alpha subunit of heterooctameric phosphofructokinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

  • 1,2-diacyl-sn-glycero-3-phosphocholine metabolic process (IEA) | GO:0006653

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09983.1 4.998065322133077e-171
Description: hypothetical protein (764 aa)
Oxytricha Contig14330.0.g57 1.0001043265246556e-154
Description: Phosphofructokinase
Stentor Coeruleus SteCoe_6667 2.6395702969591894e-66
Description: None
WormBase WBGene00022199 5.998633383648922e-18
Description: locus:pfk-1 6-phosphofructokinase status:Confirmed UniProt:Q9TZL8 protein_id:CCD71595.1
SGD YGR240C 3.001003044337619e-17
Description: PFK1 Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes
DictyBase DDB_G0274111 9.997764199084386e-16
Description: pfkA on chromosome: 2 position 4510635 to 4513139

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00170320(coding)
ATGGATTTGTAAAAGAGTTTAACAGATAACAAGTTTTTCGTAGCCGGATTAGCATTAGGC
TCTGGATTAATTACTTCATTATTGTTGAAGTAATTCAATACTGAAGAAGAAAAAGTTGAA
AGAAAGGGAAGCCTTAAAACAGTCAAAAGAAAGGAAGTCAAGAAGCAAAGAACAGTTTTC
TTGCATCAAACTGATAACACTATCCCTAAAGAAATTCTTAATGCTAGCAACACTCTCATG
GAAGAAGTTAAGAATCTTGAAAGTAGAACTTGCAATATTTTAAAGGTTCCTAACTTGATC
ATTGAAGTCCCTCAAGATGAAATTCCATGCCATCTATCTCCCCTTTATGGTGAAAACAAT
TACAGAGAAGTCTTTGGTGGTGGTGGTTTCCTTCCAGACACTGCATTCGTTTACACTGGC
TCATACGTATTATCTGACGCTGTTATTGGTAAGAACCAGAGCTTAGATTAATCTAAGAGA
TACGTTCGTGCTGGTCCTAGAAAGCACAATTACTTTAATCCTTAATAGGTTAAGGCTGCC
ATCGTAACCTGTGGTGGTTTATGCCCTGGTTTGAATGTTGTTATTAGAGAAATATTCATG
TGTTTATACTTCAATTACGGTGTAAGAACTATCTATGGTATTAAATACGGATATAAGGGT
TTCTACTAATATGACTGGTAAGAACTTACTGTCAAGGATGTTAAGGAAATATAAAGACTT
GGTGGTACTGTTTTGGGTAGCTCTAGAGGTGGTTTTGATAAAGATAAAATTGTTGATAAT
TTAGTTAAGCATGGTATCACTCATGTTTACTGCTTAGGTGGTGACGGTACTCATAGAGGT
ATTTAAGCTCTTTTTAACGAAGTTAGAAGCAGAAAACTCAATATTAGTATCGTAGGTATT
CCAAAAACTATTGATAACGATATTCCAATTATAGATAAATCTTTCGGTTTTGAAACTTCA
GTTGAGGAAGCTGTTAAGGCAATCTAATCTGCTCATGTTGAAGCTCACTGTGCTGAATAT
GGTGTTGGTCTTGTCAGACTTATGGGTAGATATGCAGGTTTTATTGCTATGGAGGCAACT
AATGCTTCAAGAGATGCTCATGTTTGCTTAGTACCTGAATTCAAGTTTAATCTTTACGGT
GAGGAAGGTGTGTTAGAATACGTCTATCAAAGATTATTATCCAAAAGAAATTGTATTGTT
GTAGTTGCTGAAGGTGCTGGTGAAGCAGTTTTAGATGCACAATTTGCTAACACTGGTGAA
AAGGATGCTTCAGGAAATGCCAAGTTAAATGACATTGGTGCTTTCTTATAGAAGGAAATT
GTAGATTACGGTAAAAAGAAAGGAATGGAAGTCACTCTTAAATACATTAATCCCACATAC
ATGATTAGAACTGTACCAGCTAATGCTTTGGACAGAAAAATGTGCACATAACTTGCTTAA
AATGCAGTCCATGGTGCTATGGCAGGCTTTACTGGATTCACTGTTGGTCATGTTAATAAC
CGTTTGTGTTATATTCCATTAGACGAAATCTGTAAAGAAGGATCTGGAAGAAGAATCAAG
GCAGAAGATAGAGCTTGGTAGAGACTTCTTGCATCTACTGGCTAACCCTCCTTTTTAAAG
AAAGAAAATTGA


>TTHERM_00170320(gene)
ATGGATTTGTAAAAGAGTTTAACAGGTAAATTAGATATTTCACTTTGAAATTATCTTCTT
ACTAAGGCTAATACATTTTTATATTTAGATAACAAGTTTTTCGTAGCCGGATTAGCATTA
GGCTCTGGATTAATTACTTCATTATTGTTGAAGTAATTCAATACTGAAGAAGAAAAAGTT
GAAAGAAAGGGAAGCCTTAAAACAGTCAAAAGAAAGGAAGTCAAGAAGCAAAGAACAGTT
TTCTGTAAAATTTGAATTAACAAATTAGCATTTCTTACATTTGTTTTATAAATAACTTCA
AATAGTGCATCAAACTGATAACACTATCCCTAAAGAAATTCTTAATGCTAGCAACACTCT
CATGGAAGAAGTTAAGAATCTTGAAAGTAGAACTTGCAATATTTTAAAGGTTCCTAACTT
GATCATTGAAGTCGTAATACTTTGTCTTTTTTAGCATCATTTTTTAGTTAATTTTAACAA
TGCATTAAAATTTGATTAAATAATTTTAAGTCGCAACAACCAAACTGTGACTCTTAATAA
TATCCCACATTATCACGATGCACATAAAATGCTACAAATTAATAAAACTTCTTTAAATAT
AATGCATAACTAGTTAAGCCAGCACTATGAAAGTTTAATAAATAAATTTTAATGTATATC
AGCTATTAGCTTATCTATGAATTATTTTATAAAATATTATTTTAATGCCACTTTCAATTT
TACTTTTAAATTAATATAAAGCCTCAAGATGAAATTCCATGCCATCTATCTCCCCTTTAT
GGTGAAAACAATTACAGAGAAGTCTTTGGTGGTGGTGGTTTCCTTCCAGACACTGCATTC
GTTTACACTGGCTCATACGTATTATGTAATCAAAGATATTCAATTCCTATTAGAAAACTT
TCAAAATTTACCTTTCAGCCATTTTATAGAAAAAAATACAAACAAAAAAAAATAGAGTTT
TTTAAATCAATAAATCAAATCTAAGTTAATTAAATAAGTAAATAAACTCGAATAAAGATG
CATAAATTATATCAGATTCTATTTAGAGCAAACCTAATTATTAAATATTCCTTACATGAT
AATTGAGATTACTCTGTTTAAACAATACCTACCTATCAATAATAAATAAGTCCATAGCTA
TTTTTGATGCTAAAAGACTCGTTGAGATAAATAATATAAATGTTTTATAGATAAACTTGA
AATAAAATAAATACTATTTTGTTATATTAGATATAAAAATTATAATTAATTTTATAAACA
ATTGTGATAGAATTATATTAAAATATTTTGAATAATAAATAGCTGACGCTGTTATTGGTA
AGAACCAGAGCTTAGATTAATCTAAGAGATACGTTCGTGCTGGTCCTAGAAAGCACAATT
ACTTTAATCCTTAATAGGTTAAGGCTGCCATCGTAACCTGTGGTGGTTTATGCCCTGGTT
TGAATGTTGTTATTAGAGAAATATTCATGTGTTTATACTTCAATTACGGTGTAAGAACTA
TCTATGGTATTAAATACGGATATAAGGGTTTCTACTAATATGACTGGTAAGAACTTACTG
TCAAGGATGTTAAGGAAATATAAAGACTTGGTGGTACTGTTTTGGGTAGCTCTAGAGGTG
GTTTTGATAAAGATAAAATTGTTGATAATTTAGTTAAGCATGGTATCACTCATGTAAATT
ATATTTTTTGATAAAAGGCACTTTTTTTAAATATTCAAATTTTAATAAAATGATTTTAGG
TTTACTGCTTAGGTGGTGACGGTACTCATAGAGGTATTTAAGCTCTTTTTAACGAAGTTA
GAAGCAGAAAACTCAATATTAGTATCGTAGGTATTCCAAAAACTATTGATAACGATATTC
CAATTATAGATAAATCTTTCGGTTTTGAAACTTCAGTTGAGGTAAAAATTTATTTAATTA
TTTGAGTTATTTTTAGCTCCATATAAAAAGAAATTTAGGTAGATTTATTTACATTTTCAG
TATTATTTTAAATAGCATTTAGGAATTTAATTAAATAGGTTGATTTACTTACTTTAAAAT
ATAGCAAATTTTGAAAAAGAAAATTAAAAAATGAAAATATAAACTTATAATTTTAATTAA
TTAATTAATTAAAATAGGAAGCTGTTAAGGCAATCTAATCTGCTCATGTTGAAGCTCACT
GTGCTGAATATGGTGTTGGTCTTGTCAGACTTATGGGTAGATATGCAGGTTTTATTGCTA
TGGAGGCAACTAATGCTTCAAGAGATGCTCATGTTTGCTTAGTACCTGAATTCAAGTTTA
ATCTTTACGGTGAGGAAGGTGTGTTAGAATACGTCTATCAAAGATTATTATCCAAAAGAA
ATTGTATTGTTGTAGTTGCTGAAGGTGCTGGTGAAGCAGTTTTAGATGCACAATTTGCTA
ACACTGGTGAAAAGGATGCTTCAGGAAATGCCAAGTTAAATGTAAAAATAAAATTTAGAG
AAAAAAGAGTGATATTTATTTGAATATCTTTTTTAAAATAAATAGGACATTGGTGCTTTC
TTATAGAAGGAAATTGTAGATTACGGTAAAAAGAAAGGAATGGAAGTCACTCTTAAATAC
ATTAATCCCACATACATGATTAGAACTGTACCAGCTAATGCTTTGGACAGAAAAATGTGC
ACGTAAGTGATAAATTAAAATAATAAAAAAATAATTAAAACTTTAATTTTAAAAGATAAC
TTGCTTAAAATGCAGTCCATGGTGCTATGGCAGGCTTTACTGGATTCACTGTTGGTCATG
TTAATAACCGTTTGTGTTATATTCCATTAGACGAAATCTGTAAAGAAGGATCTGGAAGAA
GAATCAAGGCAGAAGATAGAGCTTGGTAGAGACTTCTTGCATCTACTGGCTAACCCTCCT
TTTTAAAGAAAGAAAATTGA


>TTHERM_00170320(protein)
MDLQKSLTDNKFFVAGLALGSGLITSLLLKQFNTEEEKVERKGSLKTVKRKEVKKQRTVF
LHQTDNTIPKEILNASNTLMEEVKNLESRTCNILKVPNLIIEVPQDEIPCHLSPLYGENN
YREVFGGGGFLPDTAFVYTGSYVLSDAVIGKNQSLDQSKRYVRAGPRKHNYFNPQQVKAA
IVTCGGLCPGLNVVIREIFMCLYFNYGVRTIYGIKYGYKGFYQYDWQELTVKDVKEIQRL
GGTVLGSSRGGFDKDKIVDNLVKHGITHVYCLGGDGTHRGIQALFNEVRSRKLNISIVGI
PKTIDNDIPIIDKSFGFETSVEEAVKAIQSAHVEAHCAEYGVGLVRLMGRYAGFIAMEAT
NASRDAHVCLVPEFKFNLYGEEGVLEYVYQRLLSKRNCIVVVAEGAGEAVLDAQFANTGE
KDASGNAKLNDIGAFLQKEIVDYGKKKGMEVTLKYINPTYMIRTVPANALDRKMCTQLAQ
NAVHGAMAGFTGFTVGHVNNRLCYIPLDEICKEGSGRRIKAEDRAWQRLLASTGQPSFLK
KEN