Identifiers and Description

Gene Model Identifier

TTHERM_00181100

Standard Name

PUS3 (PseudoUridine Synthase 3)

Aliases

PreTt29828 | 14.m00395 | DEG1

Description

PUS3 tRNA pseudouridine synthase; tRNA pseudouridine synthase A family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01416 ) tRNA pseudouridine synthase
  • ( TIGR00071 ) tRNA pseudouridine synthase A

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09939.1 9.997093137033517e-262
Description: tRNA pseudouridine synthase A family protein (498 aa)
DictyBase DDB_G0288909 2.998830401637127e-79
Description: pus3 on chromosome: 5 position 2110038 to 2111898
WormBase WBGene00006473 7.002037867398653e-67
Description: locus:tag-124 Probable tRNA pseudouridine synthase tag-124 status:Confirmed UniProt:Q09524 protein_id:CAA87378.1
SGD YFL001W 6.997942222381785e-66
Description: DEG1 tRNA:pseudouridine synthase, introduces pseudouridines at position 38 or 39 in tRNA, important for maintenance of translation efficiency and normal cell growth, localizes to both the nucleus and cytoplasm; non-essential for viability
Oxytricha Contig18928.0.g26 1.9997677415930956e-65
Description: tRNA pseudouridine synthase
Stentor Coeruleus SteCoe_32353 1.603810890548638e-28
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00181100(coding)
ATGGATACAATTTAATAAAGCGAATAAGGAAATATACAAATATCTTAAGAAGGCCAAAGT
GAATAGAAAGCTAACTAAGATATTAAAAAAGATGAAGAGCAAAAAAGCGAGTCATTAGAA
AGTGAAGACTTAGATAAATTTTCTAAGGAAGAAATCATTAAAAAATATTTGTTCATAAAA
AAGGAAAATTAAGTTTTAAGAAAATAATTAAACCATAACAACGACACAAAAGCCCCTATT
CCTAATAATAGCTCTTAAAATGAGACTAAAAAGTAAAAGAAAGAGCAAAAATAGAATAAC
AAAAAGGAAAGCCTATTCGAAATCTACCAATAACAGCATTATGCCTTAAAAATGTCTTAT
GTTGGAATCAATTATCAAGGCTTAGCATATTAGTAAGAAACTGACAACACTGTAGAAGAA
TAGCTCTTCAAGGCACTTGAAAAGACAACACTGATAAAAAATAGAGATAATTGCAATTTC
ACACGTTCAGGAAGAACTGACAAAGGAGTTAGTGCTTTAGGATAAGTTATTGGTATCACT
CTTAGAACTTCAATAAAAATAGGTGAAAATATTGATGAAATAGAAAATAAATTAGATTAC
ATTAAGATGCTTAATAGTAATCTTCCAGACGACATAAGGATTTTAGGTTGTTCTAAAGTT
GATCCTGCTTTTAATGCAAGATTTGATTGTTAAAAGAGAATTTATAAGTATTACTTTTTT
GAGAATTAGATGGATATTTAAAGAATGAAGGAAGCAGCTAACCTCTTTTTGGGAGAACAC
GATTTTAGAAATTTCTGCAAAATAGATGTTTTGCAAACACTTAACTATGTTAGAATTATT
TATTAACTTGATATAGAAGAAGTTTAGGCTAATTTTGGTACTCTTGACCCTCGTTCTAAA
TTATATGTAGCAACTATTCAAGGAAGTGCTTTCCTTTGGCATTAAATCAGAAACATGATG
GCTATACTTTTTCTAGTAGGCAGAAAATAAGAAGAACCTTCAATAGTTACAGAGCTTCTT
GATATTTAAAAGAATCCATCTAAACCTAATTATGAGATGGCTCCTGATTATCCTCTAGTA
TTATTTGATTGCTTGTACAATAATGTTAGTTTTAACTACAGTAGCGATTAGATAAAGATT
TATGAACATTATTTGCAGATAATCTAAAAAAAGTGTATCGAAAATTAGCTTTATATTACA
ACTCTCAATTATATGGCATAAACTGCTTAGCAATTTAACAATTATAATCTTATTTAAAAT
TCATTGATTTCAGAAGAAGCTACTCTTCGTAATAAGAAATACTAGCATCTTTCAAAAAGA
TAATGTGCTTAATCATCAGAAGACACTTTAAAAAATTTAAAAGGCAGAAAATTAGATAAG
TTTTTAATTAAGCAAGAAAAATAGATAAATTATTAATAGTAGCGCGAAGCAGAAAAGAAT
TTATCATAAACATAAGATTAAACCTCTGAAGGAAACGATACTTAAGAATGA


>TTHERM_00181100(gene)
ATGGATACAATTTAATAAAGCGAATAAGGAAATATACAAATATCTTAAGAAGGCCAAAGT
GAATAGAAAGCTAACTAAGATATTAAAAAAGATGAAGAGCAAAAAAGCGAGTCATTAGAA
AGTGAAGACTTAGATAAATTTTCTAAGGAAGAAATCATTAAAAAATATTTGTTCATAAAA
AAGGAAAATTAAGTTTTAAGAAAATAATTAAACCATAACAACGACACAAAAGCCCCTATT
CCTAATAATAGCTCTTAAAATGAGACTAAAAAGTAAAAGAAAGAGCAAAAATAGAATAAC
AAAAAGGAAAGCCTATTCGAAATCTACCAATAACAGCATTATGCCTTAAAAATGTCTTAT
GTTGGAATCAATTATCAAGGCTTAGCATATTAGTAAGAAACTGACAACACTGTAGAAGAA
TAGCTCTTCAAGGCACTTGAAAAGACAACACTGATAAAAAATAGAGATAATTGCAATTTC
ACACGTTCAGGAAGAACTGACAAAGGAGTTAGTGCTTTAGGATAAGTTATTGGTATCACT
CTTAGAACTTCAATAAAAATAGGTGAAAATATTGATGAAATAGGTAATATTAATTAAGTT
AGTCTATATTATATATAAATATTTATTTATTATTTACTTTGATAGAAATAACAATTTTAA
AATATTTATTTTTTACAATGTGATAGAAAATAAATTAGATTACATTAAGATGCTTAATAG
TAATCTTCCAGACGACATAAGGATTTTAGGTTGTTCTAAAGTTGATCCTGCTTTTAATGC
AAGATTTGATTGTTAAAAGAGAATTTATAAGTATTACTTTTTTGAGAATTAGATGGATAT
TTAAAGAATGAAGGAAGCAGCTAACCTCTTTTTGGGAGAACACGATTTTAGAAATTTCTG
CAAAATAGATGTTTTGCAAACACTTAACTATGTTAGAATTATTTATTAACTTGATATAGA
AGAAGTTTAGGCTAATTTTGGTACTCTTGACCCTCGTTCTAAATTATATGTAGCAACTAT
TCAAGGAAGTGCTTTCCTTTGGCATTAAATCAGAAACATGATGGCTATACTTTTTCTAGT
AGGCAGAAAGTAATTATTTAGTTAGAAATTTAGTTTAAATACTTTATGAGTAATATTTAT
TATTTTAGATAAGAAGAACCTTCAATAGTTACAGAGCTTCTTGATATTTAAAAGAATCCA
TCTAAACCTAATTATGAGATGGCTCCTGATTATCCTCTAGTATTATTTGATTGCTTGTAC
AATAATGTTAGTTTTAACTACAGTAGCGATTAGATAAAGATTTATGAACATTATTTGCAG
ATAATCTAAAAAAAGTGTATCGAAAATTAGCTTTATATTACAACTCTCAATTATATGGCA
TAAACTGCTTAGCAATTTAACAATTATAATCTTATTTAAAATTCATTGATTTCAGAAGAA
GCTACTCTTCGTAATAAGAAATACTAGCATCTTTCAAAAAGATAATGTGCTTAATCATCA
GAAGACACTTTAAAAAATTTAAAAGGCAGAAAATTAGATAAGTTTTTAATTAAGCAAGAA
AAATAGATAAATTATTAATAGTAGCGCGAAGCAGAAAAGAATTTATCATAAACATAAGAT
TAAACCTCTGAAGGAAACGATACTTAAGAATGA


>TTHERM_00181100(protein)
MDTIQQSEQGNIQISQEGQSEQKANQDIKKDEEQKSESLESEDLDKFSKEEIIKKYLFIK
KENQVLRKQLNHNNDTKAPIPNNSSQNETKKQKKEQKQNNKKESLFEIYQQQHYALKMSY
VGINYQGLAYQQETDNTVEEQLFKALEKTTLIKNRDNCNFTRSGRTDKGVSALGQVIGIT
LRTSIKIGENIDEIENKLDYIKMLNSNLPDDIRILGCSKVDPAFNARFDCQKRIYKYYFF
ENQMDIQRMKEAANLFLGEHDFRNFCKIDVLQTLNYVRIIYQLDIEEVQANFGTLDPRSK
LYVATIQGSAFLWHQIRNMMAILFLVGRKQEEPSIVTELLDIQKNPSKPNYEMAPDYPLV
LFDCLYNNVSFNYSSDQIKIYEHYLQIIQKKCIENQLYITTLNYMAQTAQQFNNYNLIQN
SLISEEATLRNKKYQHLSKRQCAQSSEDTLKNLKGRKLDKFLIKQEKQINYQQQREAEKN
LSQTQDQTSEGNDTQE