Identifiers and Description

Gene Model Identifier

TTHERM_00185770

Standard Name

CDK9 (Cyclin-Dependent Kinase 9)

Aliases

PreTt29899 | 14.m00466

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; CDKL kinase family protein; involved in DNA replication

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09902.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (707 aa)
Oxytricha Contig9279.0.0.g16 9.997639769646959e-151
Description: Protein kinase domain
WormBase WBGene00012779 1.9993206333383003e-80
Description: status:Partially_confirmed UniProt:Q9U2H1 protein_id:CAB63367.1
DictyBase DDB_G0288677 5.001742359316081e-68
Description: cdk5 on chromosome: 5 position 1885785 to 1886770
Stentor Coeruleus SteCoe_22120 7.175095973164411e-66
Description: None
SGD YBR160W 5.997098480211051e-62
Description: CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00185770(coding)
ATGAATAAATATGAAGTTAAAGGAGTTGTGGGTGAAGGCGCATATGGCGTTGTTTTAAAG
TGTATGAATAAGGAAAACGGAGAATATGTTGCTATAAAGAAATTCAAGGAATCAGATGAG
GATGAAGTGGTTAAGAAGACCACTCTCAGAGAAGTTAAAATTTTAAGAATGCTTAAGTAA
GAAAATATAGTTCAGTTAAGAGAAGCATTCAGAAGAAAGGGAAAATTGTATTTAGTCTTT
GAATATGTTGAAAACAACTTGCTTGAAATTCTTGAAGAAAGGCCGAATGGGCTGGATCAA
GACGATGTTAGAAAATATATTTATCAGTTATGCAAGAGTATTAGTTATTGCAACTCAATG
GATATTATACATAGAGATATTAAGCCAGAAAATCTTCTCATTAGCAAGGATGGTACTCTC
AAGCTTTGTGATTTTGGATTTGCCAGAGTTTTGCCTTAGAAAGGAGGCAACTTAACAGAT
TATGTTGCTACTAGATGGTATAGAGCACCAGAGTTGCTTCTTGGTTACACAGATTATGGT
AAAGAAGTAGATATGTGGGCTGTAGGTTGTATTATGGGAGAATTAACTGATGGATAGCCT
CTCTTTCCAGGATAAAATGAGATAGATTAACTCTATGTGATTTAAAAAGTACTAGGACCA
CTAACTGCTGAACAATAAGAAGTATTTTTAAAACATCCTGGATTCTTGGGAGTAAAATTA
CCAGAAATAAGTAAACCAGAAACAATAGAAAAGAGATATTTGGGAAAACTATCAAAAAAA
GCCCTTTCATTTATGAAAAACCTACTTAAAATGGATCCTTCTTAAAGAATGAGTGCAGAT
GAGGCTTTATAGCACCCTTATTTCGATGGAATTAGAGATAAAGAAATTTAATAAACAATT
AAACATGGAAGAATTGAAGAAAGAGTAGAATCTGCAACAATTAAAGAGCCTAAACAAATC
AATTAAAATGGCACAAATTCTGGTTTTTATAATTAACAAACTTAAAATGCTTCAACTATT
AAGCCAAAAGATAAACCTCCTCAATAATAAGCTATTCCTCCAAAAAATTAAACTCAATAA
CCACCTCTTGGATCTAACAAACAAAAGGCATTACAGTAGTAACCAGACCAATAATAATAA
AGAGTTAATAACTTTGTAAAAAATGGCGTAAGACAAGAAAAGAATACTCCAAGTCATGAG
AATAATAGAATAATTAAAAAAGATATTTATCCTCATCCATAAATAAACTTTATGTAGTCA
AGCTATTCAAATATTCCAGATATTTACATTAAAACGAAAAATGCTCAAAATCAGCAGTAT
AATTATGAAATTCAAGAAAATTATCAACCAGATTTTCATAATGAGGACCCAGATGATTCA
CAGTAACCTTCCGTTCCCCAAGTGTTAATTAGAAACGACACTCATGGAAATCATAATAAT
ATGGTTAACGTTTCAATCGAAGATAATACTCCATACTCTAAATTTAATGAAAGAAATAAA
TCGAAAGAAAACATCATACCAAAAGGAAAGAAGAAAAAATCATAGATGTCAAATATAGAA
AATTTCTATCAAGATAATGCAGAAAATTCTAATAATCAAGAAGAAGATGCAGAAGGTCGC
AAAAGCCCTCTTCTGACAAATAACAAACTTTATGGTACATCAGTCGCACAGCAAAAGAAA
TTCAGATTTAATGTTATGGCTCAGAATATTCAACAAAATGAGGAGGCTTAAGAATATCCA
AGATAATAAAGTAGAGCAAATAGCAGGTCTAAATTTTATAAAAATGGATAACTCCAAAAG
AATGCCAACTATGTAAGTTCATAGCAGATGAATGTGCTTTTGCACACAGAAGAAGGTCCT
GACTATGAAGAGAAAGGACTTAATTTAAATAGCAACACAAATAATAATAATATGAACGTA
AACAATAACAATATCAGTAGTTAAAATATGATGGAATAGCAAGTAATGGGAAATGAAATC
TTTTAGAGTACTAGTTAATTGCCTTATATTTAGTAATCATCTTCAAATTATAATCCAAAC
TTTAAATTTTATAATATGTACCATTAGTAATAGAAGTAGACCTAAAAACCAAGTGGTAAA
ATGAGTACTTAACATAATAATAATACAAATTAAAATATGAATTACGACCAATATACTTAC
TCAATGCACCCTTACGATTAGTAAGATTAAGAAATGAAGAACTTAAACATAATTTACAAC
AATAATACATACAATTATAATATAAATAACTCTCCACTTTGGAATTCGATTAGCAAGAAA
AAAATATGA


>TTHERM_00185770(gene)
ATGAATAAATATGAAGTTAAAGGAGTTGTGGGTGAAGGCGCATATGGCGTTGTTTTAAAG
TGTATGAATAAGGAAAACGGAGAATATGGTAAATTTACTTATTATTACTATTAATATTAA
AGTGAAACATCAACATTTATTTTAAGGTTATTTTCAATTCAATATGATTTATCAAACAAT
AAACCAACAAATATATAATAAATATAATGTTAGATTAATATTTAACCAATATTATCATTA
GTTGCTATAAAGAAATTCAAGGAATCAGATGAGGATGAAGTGGTTAAGAAGACCACTCTC
AGAGAAGTTAAAATTTTAAGAATGCTTAAGTAAGAAAATATAGTTCAGTTAAGAGAAGCA
TTCAGAAGGTACATATTTATAAATAAAGAAATAAATAGAATAAAATGAGATAAATATAAA
ATTGGAGCTTTTTTGAATAAATAAATAAGAATAGAATAAAATATTTCTTTATATTTTTAT
TATTAGTTTAAGGAAATTTGCTAGTTTGTTTAATTGTTTCGTTTGATTAAAGAAACAGCT
AGCTACAGATAAATTATATGCATAATCATAATTGTATTAAATAGAAAGGGAAAATTGTAT
TTAGTCTTTGAATATGTTGAAAACAACTTGCTTGAAATTCTTGAAGAAAGGCCGAATGGG
CTGGATGTAATTAATTTATTATTAACATACATATTCAAGTCATTAAAAAAATAGTTTAAT
GAAGTTAACTTATTTATTTATTAATTCTAACTCTTTTTATATATCTGTTTATTAGCAAGA
CGATGTTAGAAAATATATTTATCAGTTATGCAAGAGTATTAGTTATTGCAACTCAATGGA
TATTATACATAGAGATATTAAGCCAGAAAATCTTCTCATTAGCAAGTAATATTTTAGAAT
AGCTTGTTTCTTTTCATAAATTCACGATTGATTGATTGATTGATTGATTGCTTAATTTGT
TCTTGATAAAATTAATTTGCTAATATTGCTTTTCATTAAATTTTATTAAAGGGATGGTAC
TCTCAAGCTTTGTGATTTTGGATTTGCCAGAGTTTTGCCTTAGAAAGGAGGCAACTTAAC
AGATTATGTTGCTACTAGATGGTAAATATCTAAATAACTAAATAACAATTTTAATTATTT
ATTTTTTTAGTTCATTTTAAAATATATTTCATTCGTTTTGAACTAAAAATTTGATAAATA
TTTTACTTAATTGAGATATTTATTCTAAAACCAAATATATTTCTAATTCGTTTATTGATT
TATAGGTATAGAGCACCAGAGTTGCTTCTTGGTTACACAGATTATGGTAAAGAAGTAGAT
ATGTGGGCTGTAGGTTGTATTATGGGAGAATTAACTGATGGATAGCCTCTCTTTCCAGGA
TAAAATGAGATAGATTAACTCTATGTGATTTAAAAAGTACAAATAATTTATTTATTTAAT
TAGTAAATTTAAGCTAAATTATAAGCTTTTTATTGATTTATTAAGCTCTTTTAAAGAGTA
TCCTAGTACCTTTTTACTTAATTATTATGCTTTTGCTGAATTTTCTAAAAATTTTTGTGA
ATTTAAACAAAAATTCATAGATTTTTTATTATAATTGGATAACAAATTGTATTTGCCCAC
ATAATATTCAATATATGATTACTTTAAATAAATTATATTTTATTCAAATAGGTACTAGGA
CCACTAACTGCTGAACAATAAGAAGTATTTTTAAAACATCCTGGATTCTTGGGAGTAAAA
TTACCAGAAATAAGTAAACCAGAAACAATAGAAAAGAGATATTTGGGAAAACTATCAAAA
AAAGCCCTTTCATTTATGAAAAACCTACTTAAAATGGATCCTTCTTAAAGAATGAGTGCA
GATGAGGCTTTATAGCACCCTTATTTCGATGGAATTAGAGATAAAGAAATTTAATAAACA
ATTAAACATGGAAGAATTGAAGAAAGAGTAGAATCTGCAACAATTAAAGAGCCTAAACAA
ATCAATTAAAATGTAATAAATTATAATTTTTATTTTTGTGTTATGAGTTTATTTTTTAAA
AAAGGGCACAAATTCTGGTTTTTATAATTAACAAACTTAAAATGCTTCAACTATTAAGCC
AAAAGATAAACCTCCTCAATAATAAGCTATTCCTCCAAAGTAAGTATTTTTATTTATAAA
AGCATCAAAAAAATAATTTAAATTTAATAAAGAAATTAAACTCAATAACCACCTCTTGGA
TCTAACAAACAAAAGGCATTACAGTAGTAACCAGACCAATAATGTAAAATTTATATATTT
ATTTTAAAGGTTTTTATTAATTTAAAAAGTATCAATCTACCTACCTACCTACCCATCATT
TATCATATTAATCAAATAAAAAATAATTTTTTTAAGTTTTTAATCGACTCATTTATCATC
AAATAGATGATAAAAATGTTTAAAATAAATTGATATTTTACAATAAATAATATTAATATT
CCATAAAATATATTTAATTAGAATAAAGAGTTAATAACTTTGTAAAAAATGGCGTAAGAC
AAGAAAAGAATACTCCAAGTCATGAGAATAATAGAATAATTAAAAAAGATATTTATCCTC
ATCCATAAATAAACTTTATGTGTAAGAAAAGCTTATTTATATAAAAACTTCTTTTTTGCT
TAATAGAATTTTTTAATTTTTATAATAGAGTCAAGCTATTCAAATATTCCAGATATTTAC
ATTAAAACGAAAAATGCTCAAAATCAGCAGTATAATTATGAAATTCAAGAAAATTATCAA
CCAGATTTTCATAATGAGGACCCAGATGATTCACAGTAACCTTCCGTTCCCCAAGTGTTA
ATTAGAAACGACACTCATGGAAATCATAATAATATGGTTAACGTTTCAATCGAAGATAAT
ACTCCATACTCTAAATTTAATGAAAGAAATAAATCGAAAGAAAACATCATAGTATCTAAT
AAAAATCAATCACTCATTTAATCTAAAAAAATATAATTTTATTAAGCCAAAAGGAAAGAA
GAAAAAATCATAGATGTCAAATATAGAAAATTTCTATCAAGATAATGCAGGTATTTTCTT
ATTTTATTATATTATGAATAATAATTCAACAAAAAGTGATTTATTATTTAATAGAAAATT
CTAATAATCAAGAAGAAGATGCAGAAGGTCGCAAAAGCCCTCTTCTGACAAATAACAAAC
TTTATGGTACATCAGTCGCACAGCAAAAGAAATTCAGATTTAATGTTATGGCTCAGAATA
TTCAACAAAATGAGGAGGCTTAAGAATATCCAAGAGTAAAAATAATTAATTTTTTTGGAT
TAAAAATTTTTCTTTTTAGTAGCTTTTTACTTTTTATAGCTAATAAATATTTACTAAAAA
TAGTAATAAAGTAGAGCAAATAGCAGGTCTAAATTTTATAAAAATGGATAACTCCAAAAG
AATGCCAACTATGTAAGTTCATAGCAGATGAATGTGCTTTTGCACACAGAAGAAGGTCCT
GACTATGAAGAGAAAGGACTTAATTTAAATAGCAACACAAATAATAATAATATGAACGTA
AACAATAACAATATCAGTAGTTAAAATATGATGGAATAGCAAGTAATGGGAAATGAAATC
TTTTAGAGTACTAGTTAATTGCCTTATATTTAGTAATCATCTTCAAATTATAATCCAAAC
TTTAAATTTTATAATATGTACCATTAGTAATAGAAGTAGACCTAAAAACCAAGTGGTAAA
ATGAGTACTTAACATAATAATAATACAAATTAAAATATGAATTACGACCAATATACTTAC
TCAATGCACCCTTACGATTAGTAAGATTAAGAAATGAAGAACTTAAACATAATTTACAAC
AATAATACATACAATTATAATATAAATAACTCTCCACTTTGGAATTCGATTAGCAAGAAA
AAAATATGA


>TTHERM_00185770(protein)
MNKYEVKGVVGEGAYGVVLKCMNKENGEYVAIKKFKESDEDEVVKKTTLREVKILRMLKQ
ENIVQLREAFRRKGKLYLVFEYVENNLLEILEERPNGLDQDDVRKYIYQLCKSISYCNSM
DIIHRDIKPENLLISKDGTLKLCDFGFARVLPQKGGNLTDYVATRWYRAPELLLGYTDYG
KEVDMWAVGCIMGELTDGQPLFPGQNEIDQLYVIQKVLGPLTAEQQEVFLKHPGFLGVKL
PEISKPETIEKRYLGKLSKKALSFMKNLLKMDPSQRMSADEALQHPYFDGIRDKEIQQTI
KHGRIEERVESATIKEPKQINQNGTNSGFYNQQTQNASTIKPKDKPPQQQAIPPKNQTQQ
PPLGSNKQKALQQQPDQQQQRVNNFVKNGVRQEKNTPSHENNRIIKKDIYPHPQINFMQS
SYSNIPDIYIKTKNAQNQQYNYEIQENYQPDFHNEDPDDSQQPSVPQVLIRNDTHGNHNN
MVNVSIEDNTPYSKFNERNKSKENIIPKGKKKKSQMSNIENFYQDNAENSNNQEEDAEGR
KSPLLTNNKLYGTSVAQQKKFRFNVMAQNIQQNEEAQEYPRQQSRANSRSKFYKNGQLQK
NANYVSSQQMNVLLHTEEGPDYEEKGLNLNSNTNNNNMNVNNNNISSQNMMEQQVMGNEI
FQSTSQLPYIQQSSSNYNPNFKFYNMYHQQQKQTQKPSGKMSTQHNNNTNQNMNYDQYTY
SMHPYDQQDQEMKNLNIIYNNNTYNYNINNSPLWNSISKKKI